Gene Details:
- Gene ID: Dca59169.1
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Dianthus caryophyllus
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_028244870.1 — transcription factor RAX3-like
- Swissprot: Q9M2Y9 — RAX3_ARATH; Transcription factor RAX3
- TrEMBL: A0A445M5H6 — A0A445M5H6_GLYSO; Transcription factor RAX3
- STRING: GLYMA01G40411.1 — (Glycine max)
Gene Ontology:
- GO:0008285 — Biological Process — negative regulation of cell proliferation
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0035987 — Biological Process — endodermal cell differentiation
- GO:0045597 — Biological Process — positive regulation of cell differentiation
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:2000021 — Biological Process — regulation of ion homeostasis
- GO:2000067 — Biological Process — regulation of root morphogenesis
- GO:0048226 — Cellular Component — Casparian strip
- GO:0000975 — Molecular Function — regulatory region DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >Dca59169.1|Dianthus_caryophyllus|MYB_related|Dca59169.1
ATGGGAAGAGCTCCATGTTGTGATAAAGCTAATGTTAAGAAAGGTCCATGGTCTCCTGAAGAAGATGCTAAGCTCAAATCTTACATTGAGAATCATGGCATGGGGGGAAACTGGATCGCCTTGCCTCAAAAAATCGGGCTTAAGAGATGCGGGAAGAGTTGTCGACTTAGATGGCTAAATTATCTAAGGCCTAATATCAAGCATGGAGGGTTCTCCGAGGACGAAGACAAGATTATCTTAAGTCTCTATCTCAGTATCGGAAGCAGGTAA
Protein Sequence:
- >Dca59169.1|Dianthus_caryophyllus|MYB_related|Dca59169.1
MGRAPCCDKANVKKGPWSPEEDAKLKSYIENHGMGGNWIALPQKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEDEDKIILSLYLSIGSR