Gene Details:

  • Gene ID: Dca59169.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Dianthus caryophyllus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_028244870.1  — transcription factor RAX3-like
  • Swissprot:  Q9M2Y9  — RAX3_ARATH; Transcription factor RAX3
  • TrEMBL:  A0A445M5H6  — A0A445M5H6_GLYSO; Transcription factor RAX3
  • STRING:  GLYMA01G40411.1  — (Glycine max)

Gene Ontology:

  • GO:0008285  — Biological Process — negative regulation of cell proliferation
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0035987  — Biological Process — endodermal cell differentiation
  • GO:0045597  — Biological Process — positive regulation of cell differentiation
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:2000021  — Biological Process — regulation of ion homeostasis
  • GO:2000067  — Biological Process — regulation of root morphogenesis
  • GO:0048226  — Cellular Component — Casparian strip
  • GO:0000975  — Molecular Function — regulatory region DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Dca59169.1|Dianthus_caryophyllus|MYB_related|Dca59169.1
    ATGGGAAGAGCTCCATGTTGTGATAAAGCTAATGTTAAGAAAGGTCCATGGTCTCCTGAAGAAGATGCTAAGCTCAAATCTTACATTGAGAATCATGGCATGGGGGGAAACTGGATCGCCTTGCCTCAAAAAATCGGGCTTAAGAGATGCGGGAAGAGTTGTCGACTTAGATGGCTAAATTATCTAAGGCCTAATATCAAGCATGGAGGGTTCTCCGAGGACGAAGACAAGATTATCTTAAGTCTCTATCTCAGTATCGGAAGCAGGTAA
Protein Sequence:
  • >Dca59169.1|Dianthus_caryophyllus|MYB_related|Dca59169.1
    MGRAPCCDKANVKKGPWSPEEDAKLKSYIENHGMGGNWIALPQKIGLKRCGKSCRLRWLNYLRPNIKHGGFSEDEDKIILSLYLSIGSR