Gene Details:

  • Gene ID: Cucsa.201970.1
  • Gene Name: Csa_5G139610, TRY
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Cucumis sativus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004145923.1  — PREDICTED: transcription factor TRY
  • Refseq:  XP_011654628.1  — PREDICTED: transcription factor TRY
  • Swissprot:  Q8GV05  — TRY_ARATH; Transcription factor TRY
  • TrEMBL:  I6NF75  — I6NF75_CUCSA; R3 MYB transcription factor
  • STRING:  XP_004145923.1  — (Cucumis sativus)
  • STRING:  XP_004160369.1  — (Cucumis sativus)

Gene Ontology:

  • GO:0010091  — Biological Process — trichome branching
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Cucsa.201970.1|Cucumis_sativus|MYB_related|Cucsa.201970.1
    ATGGACAATCATCGTCACCAGAAACCGGCCAAAATCTCTCCACTAGAATCCGAAGAAGTCAGCAGCACTAGGTGGCAGTTTATAACTATGACAGCACAAGAGGAAGATCTTATCCATAGAATGCATAAGCTGATTGGAGATAGGTGGGATCTCATAGCAGGCAGAATTCCGGGGCGAAAACCAGAAGAAATAGAGAGGTATTGGATAATGACTCACCTTGAAGGGTTTGGAAAAAGAAGAAGAGGATGA
Protein Sequence:
  • >Cucsa.201970.1|Cucumis_sativus|MYB_related|Cucsa.201970.1
    MDNHRHQKPAKISPLESEEVSSTRWQFITMTAQEEDLIHRMHKLIGDRWDLIAGRIPGRKPEEIERYWIMTHLEGFGKRRRG*