Gene Details:

  • Gene ID: Csa08g053430.1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Camelina sativa
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010422763.1  — PREDICTED: MYB-like transcription factor ETC3 isoform X1
  • Refseq:  XP_010456208.1  — PREDICTED: MYB-like transcription factor ETC3 isoform X1
  • Swissprot:  Q9M157  — ETC3_ARATH; MYB-like transcription factor ETC3
  • TrEMBL:  D7M4Z5  — D7M4Z5_ARALL; Myb family transcription factor
  • STRING:  XP_010422763.1  — (Camelina sativa)
  • STRING:  XP_010456208.1  — (Camelina sativa)

Gene Ontology:

  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0010026  — Biological Process — trichome differentiation
  • GO:0010228  — Biological Process — vegetative to reproductive phase transition of meristem
  • GO:0048765  — Biological Process — root hair cell differentiation
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Csa08g053430.1|Camelina_sativa|MYB_related|Csa08g053430.1
    ATGGATAATCATCGCAGGACGAAGCAAGCCAAGACCAACTCCATTGTTACTTCTTCTTCTGAAGAAGTGAGTAGTCTTGAGTGGGAAATTGTGAACATGAATCAAGAAGAAGAAGATTTGGTCTGTAGAATGCATAAGCTTGTCGGTGACAGGTGGGAACTGATAGCTGGAAGGATCCCAGGAAGAACAGCTGAAGAAATTGAGAGGTTTTGGGTCATGAAAACTGAAAAGTGA
Protein Sequence:
  • >Csa08g053430.1|Camelina_sativa|MYB_related|Csa08g053430.1
    MDNHRRTKQAKTNSIVTSSSEEVSSLEWEIVNMNQEEEDLVCRMHKLVGDRWELIAGRIPGRTAEEIERFWVMKTEK*