Gene Details:

  • Gene ID: cra_locus_94_iso_3
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Catharanthus roseus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009588514.1  — PREDICTED: transcription factor MYB44
  • Refseq:  XP_016478014.1  — PREDICTED: transcription factor MYB44-like
  • Refseq:  XP_028080167.1  — transcription factor MYB44-like
  • Swissprot:  O23160  — MYB73_ARATH; Transcription factor MYB73
  • TrEMBL:  A0A328DM19  — A0A328DM19_9ASTE; Uncharacterized protein
  • TrEMBL:  A0A484LGT6  — A0A484LGT6_9ASTE; Uncharacterized protein
  • TrEMBL:  A0A484MEM6  — A0A484MEM6_9ASTE; Uncharacterized protein
  • STRING:  XP_009588514.1  — (Nicotiana tomentosiformis)

Gene Ontology:

  • GO:0009723  — Biological Process — response to ethylene
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0010200  — Biological Process — response to chitin
  • GO:0046686  — Biological Process — response to cadmium ion
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_94_iso_3|Catharanthus_roseus|MYB_related|cra_locus_94_iso_3
Protein Sequence:
  • >cra_locus_94_iso_3|Catharanthus_roseus|MYB_related|cra_locus_94_iso_3
    MSSNSMRKDVDRIKGPWSPEEDELLQQLVQKHGPRNWSLISKSIQGRSGKSCRLRWCNQLSPQVEXQQQQQRYLVQQHQQHVQQQQQQMMMMHNGMGMGMGMGMMQASAANDGFRNNAIKRIGINKIE