Gene Details:

  • Gene ID: cra_locus_6581_iso_2
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Catharanthus roseus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006484863.1  — myb-related protein 306
  • Refseq:  XP_012465520.1  — PREDICTED: myb-related protein 306-like
  • Swissprot:  B3VTV7  — MYB60_VITVI; Transcription factor MYB60
  • Swissprot:  Q8GYP5  — MYB60_ARATH; Transcription factor MYB60
  • TrEMBL:  A0A0D2VHT3  — A0A0D2VHT3_GOSRA; Uncharacterized protein
  • STRING:  Gorai.013G196800.1  — (Gossypium raimondii)

Gene Ontology:

  • GO:0009414  — Biological Process — response to water deprivation
  • GO:0009416  — Biological Process — response to light stimulus
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0010118  — Biological Process — stomatal movement
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_6581_iso_2|Catharanthus_roseus|MYB_related|cra_locus_6581_iso_2
Protein Sequence:
  • >cra_locus_6581_iso_2|Catharanthus_roseus|MYB_related|cra_locus_6581_iso_2
    KSTHKVEEAEEKEIIINMGRPPCCDKVGIKKGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYLRPGIKRGNFTPHEEGMIIHLQALLGNK