Gene Details:
- Gene ID: cra_locus_65242_iso_1
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Catharanthus roseus
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_011080854.1 — transcription factor DIVARICATA isoform X1
- Refseq: XP_020550520.1 — transcription factor DIVARICATA isoform X2
- Swissprot: Q8S9H7 — DIV_ANTMA; Transcription factor DIVARICATA
- TrEMBL: A0A2R6QSX6 — A0A2R6QSX6_ACTCH; Transcription factor DIVARICATA like
- STRING: XP_002525595.1 — (Ricinus communis)
Gene Ontology:
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >cra_locus_65242_iso_1|Catharanthus_roseus|MYB_related|cra_locus_65242_iso_1
Protein Sequence:
- >cra_locus_65242_iso_1|Catharanthus_roseus|MYB_related|cra_locus_65242_iso_1
XNEQERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNYVITRTPTQVASHAQKYFIRQLSGGKDKRRASIHDITTVHLNENLTTPSPENKKAPSPVHHPPAKQSX