Gene Details:

  • Gene ID: cra_locus_5618_iso_4
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Catharanthus roseus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027079999.1  — transcription factor MAMYB-like
  • Refseq:  XP_027080000.1  — transcription factor MAMYB-like
  • Refseq:  XP_027080001.1  — transcription factor MAMYB-like
  • Swissprot:  Q9ASQ2  — MAMYB_ARATH; Transcription factor MAMYB
  • TrEMBL:  A0A068UZ62  — A0A068UZ62_COFCA; Uncharacterized protein
  • STRING:  PGSC0003DMT400062221  — (Solanum tuberosum)

Gene Ontology:

  • GO:0005639  — Cellular Component — integral component of nuclear inner membrane
  • GO:0005783  — Cellular Component — endoplasmic reticulum
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_5618_iso_4|Catharanthus_roseus|MYB_related|cra_locus_5618_iso_4
Protein Sequence:
  • >cra_locus_5618_iso_4|Catharanthus_roseus|MYB_related|cra_locus_5618_iso_4
    MEFLDEDARPRFVLQSKASPQSNLPDSQTQPLHKPTLIISLSLSTIFLLLSFLYFTSEPLNSLFIWVSLSLLVGPFAPLSLTAGDIRVGLGPPLEEPSKEIEQQSDDNSSKRVSKKSFKFTRKPDDPIIGSDSVSGISSIKTNGSSIQLDNKDEVAEDWIEGEDDLLKKLMGKHPVGKPGRWEAIAEGLKRRHSVENVIKRAKEMGEKKLNDDDSYNKFLKDRKPVDKRIEEGNDEVINIGGGGWSSGEDLALLNALKAFPKETAMRWEKIAAAVPGKSKAACLKRMNELKKDFRTSKASSES