Gene Details:

  • Gene ID: cra_locus_4684_iso_3
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Catharanthus roseus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027075006.1  — protein REVEILLE 1-like isoform X1
  • TrEMBL:  A1DR85  — A1DR85_CATRO; MYB transcription factor (Fragment)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0007623  — Biological Process — circadian rhythm
  • GO:0009734  — Biological Process — auxin-activated signaling pathway
  • GO:0010600  — Biological Process — regulation of auxin biosynthetic process
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_4684_iso_3|Catharanthus_roseus|MYB_related|cra_locus_4684_iso_3
Protein Sequence:
  • >cra_locus_4684_iso_3|Catharanthus_roseus|MYB_related|cra_locus_4684_iso_3
    MAIQGQSNNSESSSTISIGNQISLHVDIPSTKNEQFQCEDDCLPKVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRESTNGDSGSGKVIEIPPPRPKRKPLHPYPRKLVSPAKSGTATSQKLTQTVSPNISSPAEEHQSPTSVLSAPCSDTPGTTDSATSDGSESLSPISSVVGAKSVGFVLSELPDLTSETKRSPSSSQVNSSADNKSPSTSQVNNCANQADQLHLVIASSLILFVQITXCDLALIYVLLNNQKLELFPQDNAFDKEGSVEVSSSQIFKLFGKTVLVIDPSRPSSSTPGAGKVQPSHQNDGKSNSTKVPLGESECLRRALPCKARGNLYPSSLQRECPDTLLCGPFHSLPWLMMYQGDSSASFVQVHSPIAIKAQPLLDKKELHRVQSCKGGSSTGSDAESESIETVEDKNIEVKFRELSQEGEVQKQKLPLLKPGAKAASFFRQKANSSKCGKGFVPYKRCLSDRDTLSAITGEEREEQRVRLCL