Gene Details:
- Gene ID: cra_locus_4684_iso_3
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Catharanthus roseus
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_027075006.1 — protein REVEILLE 1-like isoform X1
- TrEMBL: A1DR85 — A1DR85_CATRO; MYB transcription factor (Fragment)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0007623 — Biological Process — circadian rhythm
- GO:0009734 — Biological Process — auxin-activated signaling pathway
- GO:0010600 — Biological Process — regulation of auxin biosynthetic process
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >cra_locus_4684_iso_3|Catharanthus_roseus|MYB_related|cra_locus_4684_iso_3
Protein Sequence:
- >cra_locus_4684_iso_3|Catharanthus_roseus|MYB_related|cra_locus_4684_iso_3
MAIQGQSNNSESSSTISIGNQISLHVDIPSTKNEQFQCEDDCLPKVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRESTNGDSGSGKVIEIPPPRPKRKPLHPYPRKLVSPAKSGTATSQKLTQTVSPNISSPAEEHQSPTSVLSAPCSDTPGTTDSATSDGSESLSPISSVVGAKSVGFVLSELPDLTSETKRSPSSSQVNSSADNKSPSTSQVNNCANQADQLHLVIASSLILFVQITXCDLALIYVLLNNQKLELFPQDNAFDKEGSVEVSSSQIFKLFGKTVLVIDPSRPSSSTPGAGKVQPSHQNDGKSNSTKVPLGESECLRRALPCKARGNLYPSSLQRECPDTLLCGPFHSLPWLMMYQGDSSASFVQVHSPIAIKAQPLLDKKELHRVQSCKGGSSTGSDAESESIETVEDKNIEVKFRELSQEGEVQKQKLPLLKPGAKAASFFRQKANSSKCGKGFVPYKRCLSDRDTLSAITGEEREEQRVRLCL