Gene Details:
- Gene ID: cra_locus_3219_iso_9
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Catharanthus roseus
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_027070765.1 — protein REVEILLE 8 isoform X1
- Refseq: XP_027175530.1 — protein REVEILLE 8-like isoform X1
- Swissprot: Q8RWU3 — RVE8_ARATH; Protein REVEILLE 8
- TrEMBL: A1DR84 — A1DR84_CATRO; MYB transcription factor
- STRING: Solyc10g084370.1.1 — (Solanum lycopersicum)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0032922 — Biological Process — circadian regulation of gene expression
- GO:0043966 — Biological Process — histone H3 acetylation
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0048573 — Biological Process — photoperiodism, flowering
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >cra_locus_3219_iso_9|Catharanthus_roseus|MYB_related|cra_locus_3219_iso_9
Protein Sequence:
- >cra_locus_3219_iso_9|Catharanthus_roseus|MYB_related|cra_locus_3219_iso_9
MANSVAASDGSGSTSGSGSGKKVRKPYTITKSRESWTEEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNGTIAHVPPPRPKRKAAHPYPQKAPKNVLVPAQASIGYPSAVNSLAPGYPTWDDASLLVSVPPSGILPSQDEYNLHGAEADIGSKGATRISNSNISGIGSSSRTLPASEVPKQGKQGSLVHGIPDFAEVYSFIGSVFDPETKGHVQKLKEMDPINFETVLLLMRNLTVNLANPDFEPIKQVLSSYDAKQPSYELPC