Gene Details:

  • Gene ID: cra_locus_183_iso_1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Catharanthus roseus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027097519.1  — transcription factor SRM1-like
  • Refseq:  XP_027099997.1  — transcription factor SRM1-like
  • Swissprot:  Q9FNN6  — SRM1_ARATH; Transcription factor SRM1
  • TrEMBL:  A0A068VFI4  — A0A068VFI4_COFCA; Uncharacterized protein
  • STRING:  XP_008221083.1  — (Prunus mume)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_183_iso_1|Catharanthus_roseus|MYB_related|cra_locus_183_iso_1
Protein Sequence:
  • >cra_locus_183_iso_1|Catharanthus_roseus|MYB_related|cra_locus_183_iso_1
    MTADESISSMWSREQDKAFENALATYPEDTADRWEKIAADVPGKSLEEIKHHYELLVDDVSRIESGTVPLPCYTTASDGSSSHAGDEGSGKKGGNFGHFNSDSNHGGKASRSDQERRKGIAW