Gene Details:

  • Gene ID: cra_locus_16251_iso_1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Catharanthus roseus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_024935245.1  — LOW QUALITY PROTEIN: transcription factor MYB1-like
  • TrEMBL:  A0A2R6RWV3  — A0A2R6RWV3_ACTCH; Transcription factor like
  • STRING:  EOY07337  — (Theobroma cacao)

Gene Ontology:

  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009723  — Biological Process — response to ethylene
  • GO:0009733  — Biological Process — response to auxin
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009739  — Biological Process — response to gibberellin
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0005634  — Cellular Component — nucleus
  • GO:0005737  — Cellular Component — cytoplasm
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_16251_iso_1|Catharanthus_roseus|MYB_related|cra_locus_16251_iso_1
Protein Sequence:
  • >cra_locus_16251_iso_1|Catharanthus_roseus|MYB_related|cra_locus_16251_iso_1
    MAEVAVENGAKAIDAVVDDGEQVVVDAAVDGGSGAEMLVEGYGNDGGAEGSGKGRVKGPWSPEEDVMLSRLVSKFGARNWGLIARGIPGRSGKSCRLRWCNQLDPGVKHKPFSGKFCCLFNLGSLSPFFRSNASFCADTLFVKSNVCALKQFFLSAFSSGCILVNV