Gene Details:

  • Gene ID: cra_locus_14079_iso_1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Catharanthus roseus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

Gene Ontology:

  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0010224  — Biological Process — response to UV-B
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0090379  — Biological Process — secondary cell wall biogenesis involved in seed trichome differentiation
  • GO:1903086  — Biological Process — negative regulation of sinapate ester biosynthetic process
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_14079_iso_1|Catharanthus_roseus|MYB_related|cra_locus_14079_iso_1
Protein Sequence:
  • >cra_locus_14079_iso_1|Catharanthus_roseus|MYB_related|cra_locus_14079_iso_1
    MGRSPCCEKAHTNKGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGSLXLLEDY