Gene Details:

  • Gene ID: cra_locus_1213_iso_2
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Catharanthus roseus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027075217.1  — single myb histone 6-like isoform X1
  • Refseq:  XP_027079170.1  — single myb histone 6-like isoform X1
  • Refseq:  XP_027079171.1  — single myb histone 6-like isoform X1
  • Refseq:  XP_027179811.1  — single myb histone 6 isoform X1
  • Swissprot:  C0HIA3  — SMH6_MAIZE; Single myb histone 6
  • TrEMBL:  A0A068U243  — A0A068U243_COFCA; Uncharacterized protein
  • STRING:  XP_009786348.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0006334  — Biological Process — nucleosome assembly
  • GO:0000786  — Cellular Component — nucleosome
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_1213_iso_2|Catharanthus_roseus|MYB_related|cra_locus_1213_iso_2
Protein Sequence:
  • >cra_locus_1213_iso_2|Catharanthus_roseus|MYB_related|cra_locus_1213_iso_2
    MGAPKQKWTAEEEAALKAGIARYGVGKWSTILKDPEFSGVLRSRSNVDLKDKWRNINVMVNGLGSRQRGRPACKSIQLPPKPDENTMALETVVENDSDVLNVKPLAAAAERLPNATSKKPISRLDDLIMEAIAKLKEPRGSSRAIIASYIEERYCVPPNFERILATNLKLLTENQQLLKVKHQYRIVTSPTSLRVRNKPAPSLLDGVEKDSSSVERNGIKIITKAQVDAELEMMKSMSAEEAAAIAAQAIAQAEAAIAEAEAAAKEAEKAEAEAEASQCFADATAAALMEGFYRSVRV