Gene Details:

  • Gene ID: Cla018325
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Citrullus lanatus
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004487066.1  — transcription factor RAX2-like
  • Refseq:  XP_016187492.1  — transcription factor RAX2
  • Refseq:  XP_025641703.1  — transcription factor RAX2
  • Swissprot:  Q9M2Y9  — RAX3_ARATH; Transcription factor RAX3
  • TrEMBL:  A0A1S2XF85  — A0A1S2XF85_CICAR; transcription factor RAX2-like
  • TrEMBL:  A0A445AA60  — A0A445AA60_ARAHY; Uncharacterized protein
  • STRING:  XP_004487066.1  — (Cicer arietinum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Cla018325|Citrullus_lanatus|MYB_related|Cla018325
    ATGGGAAGAGCTCCATGTTGTGACAAAGCAAATGTGAAGAGAGGGCCTTGGTCACCTGAAGAAGATGCAAAGCTCAAACAACATATTCATAACCATGGGATTGGTGGCAATTGGATATCCCTCCCTCAAAAAGCTGGACTAAGCGATGCGGGAAAAGTTGCAGATTGA
Protein Sequence:
  • >Cla018325|Citrullus_lanatus|MYB_related|Cla018325
    MGRAPCCDKANVKRGPWSPEEDAKLKQHIHNHGIGGNWISLPQKAGLSDAGKVAD