Gene Details:

  • Gene ID: Cc08_g05100
  • Gene Name: GSCOC_T00042447001
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Coffea canephora
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027081674.1  — protein ODORANT1-like isoform X2
  • Refseq:  XP_027181320.1  — protein ODORANT1-like isoform X2
  • Swissprot:  P20025  — MYB38_MAIZE; Myb-related protein Zm38
  • Swissprot:  Q42379  — MYB7_ARATH; Transcription factor MYB7
  • Swissprot:  Q9FJA2  — TT2_ARATH; Transcription factor TT2
  • Swissprot:  Q9S9K9  — MYB3_ARATH; Transcription factor MYB3
  • TrEMBL:  A0A068V2B6  — A0A068V2B6_COFCA; Uncharacterized protein
  • STRING:  evm.model.supercontig_96.57  — (Carica papaya)
  • STRING:  XP_010100709.1  — (Morus notabilis)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Cc08_g05100|Coffea_canephora|MYB_related|Cc08_g05100
    ATGAATTATCTTCGGCCGGGCATCAAGAGAGGAAACATCACAGCAGCTGAGGACGACCTCATTATTCGACTCCAATCCCTGCTAGGCAATTGTTGGTCACTCATAGCTGCAAGATTGCCTGGTTGA
Protein Sequence:
  • >Cc08_g05100|Coffea_canephora|MYB_related|Cc08_g05100
    MNYLRPGIKRGNITAAEDDLIIRLQSLLGNCWSLIAARLPG*