Gene Details:

  • Gene ID: Cc06_g22630
  • Gene Name: GSCOC_T00010542001
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Coffea canephora
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_028945115.1  — transcription factor MYB11-like
  • Swissprot:  Q9FJ07  — MY111_ARATH; Transcription factor MYB111
  • TrEMBL:  A0A068VK29  — A0A068VK29_COFCA; Uncharacterized protein
  • STRING:  XP_008386735.1  — (Malus domestica)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Cc06_g22630|Coffea_canephora|MYB_related|Cc06_g22630
    ATGGGAAGAGCCCCTTGCTGTGAGAAATACATTCAAGCCAACGGAGAAGGTTCCTGGAGGTCATTACCAAAGAACGCAGGACTACTTAGATGTGGGAAGAGTTGCAGATTGAGATGGATCAACTACTTGAGGTCTGACTTGAAGCCACACCCTTGGATCAACTAA
Protein Sequence:
  • >Cc06_g22630|Coffea_canephora|MYB_related|Cc06_g22630
    MGRAPCCEKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRSDLKPHPWIN*