Gene Details:

  • Gene ID: Cc02_g17730
  • Gene Name: GSCOC_T00014297001
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Coffea canephora
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Cc02_g17730|Coffea_canephora|MYB_related|Cc02_g17730
    ATGAATTATCTTCGGCCGGGCATCAAGAGAGGAAACATCACAGCAGCTGAGGACGACCTCATTATTCGACTCCAATCCCTGCTAGGCAATCGTTGGTCACTCATAGCTGCAAGATTGCCTGGTTGA
Protein Sequence:
  • >Cc02_g17730|Coffea_canephora|MYB_related|Cc02_g17730
    MNYLRPGIKRGNITAAEDDLIIRLQSLLGNRWSLIAARLPG*