Gene Details:

  • Gene ID: Cagra.0147s0041.1.p
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Capsella grandiflora
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

Gene Ontology:

  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009718  — Biological Process — anthocyanin-containing compound biosynthetic process
  • GO:0009723  — Biological Process — response to ethylene
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009739  — Biological Process — response to gibberellin
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0010023  — Biological Process — proanthocyanidin biosynthetic process
  • GO:0046686  — Biological Process — response to cadmium ion
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Cagra.0147s0041.1.p|Capsella_grandiflora|MYB_related|Cagra.0147s0041.1.p
    ATGAACAAAATCCGCCACCGTGCTCTCTCTCCGTCTTCCGGAGTGCAACACCGTGTTAAGAGATGTCGATTGAGAGATAAAAACTACGTGAGGCCTGAAGCTAAAGAAAACAAGTTCTCAAAAGACGAAGACGACCTCCTCCTCAAGCTTCATGCACTTCTTGGCAATAGATGGTCATTGATAGCGGGAAGATTGCCTGGACGAACCGACAACGAAGTTAGGATCCATTGGGAAACTTACTTAAAGAGGAAACTCATCAAAATGGGAATCGACCCAACCAATCATCGTCTCCACCATCACGCCAGCTACATTTCCAGACGCTGCCCCAATCCCTCGCATAAGGAACTCGAAACCAAGATCATTAGTGATCAGTCTTCTTCCGTATCCGAATCATGTGGTATAACATTTTTACCCATTTCAAGTACCAATTGCTCGGAGGGTAGTACTAGTACCGGAAAAACTCTTTTGCCTGACCTCAACATCGGTCTCATCCCGACCGCGACTTCTTTGCCACTTCGTTGGCTTCAGGACTCTAGCGATTCCTCTAACTATGGGTCAACCGGTCAGGAAACGCTTATTCTATTCCAGTAA
Protein Sequence:
  • >Cagra.0147s0041.1.p|Capsella_grandiflora|MYB_related|Cagra.0147s0041.1.p
    MNKIRHRALSPSSGVQHRVKRCRLRDKNYVRPEAKENKFSKDEDDLLLKLHALLGNRWSLIAGRLPGRTDNEVRIHWETYLKRKLIKMGIDPTNHRLHHHASYISRRCPNPSHKELETKIISDQSSSVSESCGITFLPISSTNCSEGSTSTGKTLLPDLNIGLIPTATSLPLRWLQDSSDSSNYGSTGQETLILFQ*