Gene Details:

  • Gene ID: C.cajan_02001
  • Gene Name: KK1_002051
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Cajanus cajan
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_007152917.1  — hypothetical protein PHAVU_004G171200g
  • Refseq:  XP_020240004.1  — transcription factor MYBS3
  • Refseq:  XP_027923683.1  — transcription factor MYBS3-like
  • Swissprot:  Q9LVS0  — KUA1_ARATH; Transcription factor KUA1
  • TrEMBL:  A0A151SLV9  — A0A151SLV9_CAJCA; Uncharacterized protein (Fragment)
  • STRING:  XP_007152917.1  — (Phaseolus vulgaris)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >C.cajan_02001|Cajanus_cajan|MYB_related|C.cajan_02001
    TTTCTTGTTGGCCTTGAGAAGCTGGGAAAAGGTGACTGGAGGGGAATCTCTAGAAACTATGTGACTACAAGAACTCCAACACAAGTGGCTAGCCATGCTCATAAGTACTTTATTTGGCTTGCAACCATGAATAAGAAAAAGAGACGTTCAAGTCTTTTTGAGTTGGTACAAATTACCTGA
Protein Sequence:
  • >C.cajan_02001|Cajanus_cajan|MYB_related|C.cajan_02001
    FLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAHKYFIWLATMNKKKRRSSLFELVQIT