Gene Details:

  • Gene ID: Bv3_056570_rqwc.t1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Beta vulgaris
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010672339.1  — PREDICTED: transcription factor MYB1R1
  • Swissprot:  Q9FKF9  — M5162_ARATH; Probable transcription factor At5g61620
  • TrEMBL:  A0A1J6IGF3  — A0A1J6IGF3_NICAT; Transcription factor myb1r1
  • TrEMBL:  A0A1S3YS01  — A0A1S3YS01_TOBAC; transcription factor MYB1R1-like isoform X2
  • TrEMBL:  A0A1S3YS95  — A0A1S3YS95_TOBAC; transcription factor MYB1R1-like isoform X1
  • TrEMBL:  A0A1S4AZ37  — A0A1S4AZ37_TOBAC; transcription factor MYB1R1-like
  • TrEMBL:  A0A1U7WU95  — A0A1U7WU95_NICSY; transcription factor MYB1R1-like
  • STRING:  XP_010672339.1  — (Beta vulgaris)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Bv3_056570_rqwc.t1|Beta_vulgaris|MYB_related|Bv3_056570_rqwc.t1
    ATGTCTGACAATGCAGGAAATCCATGGACCAAGGAAGAGCACCAATCATTCTTGATGGGATTGCAAGCGCTAGGAAAAGGGAAGTGGAAAGGGATTGCAAAAAAGTACGTGATTTCTAGATCGCCATCTCAAGTGGCTAGTCATGCACAAAAATATTTCATCCGACTTGCAGCTTCAGAGAAAAAGAAAATAAGACCTAGTGTATTTGATGCCAACCTTCAAGAACCTCAGGTTGATGTGGATGGAAATGGGCAGAAAAAGTTTGTTGTAGGAAGCTGCACCCCAATTATGTTATATTCATATGGACCGGTGACAGTTAACTTCTCACATGAGACTTACATGTATCTGCCTCAAGGCTCAAACCCATGA
Protein Sequence:
  • >Bv3_056570_rqwc.t1|Beta_vulgaris|MYB_related|Bv3_056570_rqwc.t1
    MSDNAGNPWTKEEHQSFLMGLQALGKGKWKGIAKKYVISRSPSQVASHAQKYFIRLAASEKKKIRPSVFDANLQEPQVDVDGNGQKKFVVGSCTPIMLYSYGPVTVNFSHETYMYLPQGSNP