Gene Details:

  • Gene ID: Bradi1g67910.1.p
  • Gene Name: BRADI_1g67910
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Brachypodium distachyon
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_024313364.1  — protein RADIALIS-like 3
  • Swissprot:  Q6NNN0  — RADL3_ARATH; Protein RADIALIS-like 3
  • TrEMBL:  I1H7D6  — I1H7D6_BRADI; Uncharacterized protein
  • STRING:  BRADI1G67910.1  — (Brachypodium distachyon)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Bradi1g67910.1.p|Brachypodium_distachyon|MYB_related|Bradi1g67910.1.p
    ATGGCGTGGAGCGAGGCGGAGAACGAGAGGTTCGAGAGCGCGCTGGCGACTTACGACCCCGACATGGCCGGCCGCTGGGAGCGCGTGGCGGCAGCCGTCGGCGGCGGCAAGACGGCCGACGACGTGAGGCGCCACTTCGACCTGCTCACGGAGCACGTCGGCGACATCGAGTCCGGCCGCTACGGCTACCCCGACAACAACGGAGCCGCCAACAACGGCACTGCTGGTACCAACCATCGCACCAACGGCAGAGCCAACCGCCCCCAGACCTGA
Protein Sequence:
  • >Bradi1g67910.1.p|Brachypodium_distachyon|MYB_related|Bradi1g67910.1.p
    MAWSEAENERFESALATYDPDMAGRWERVAAAVGGGKTADDVRRHFDLLTEHVGDIESGRYGYPDNNGAANNGTAGTNHRTNGRANRPQT*