Gene Details:

  • Gene ID: Bostr.5325s0057.1.p
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Boechera stricta
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_171645.1  — Homeodomain-like superfamily protein
  • Swissprot:  Q9LNI5  — ETC1_ARATH; MYB-like transcription factor ETC1
  • TrEMBL:  A0A178WDR4  — A0A178WDR4_ARATH; ETC1
  • STRING:  Bostr.5325s0057.1.p  — (Boechera stricta)

Gene Ontology:

  • GO:0080147  — Biological Process — root hair cell development
  • GO:1900033  — Biological Process — negative regulation of trichome patterning
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Bostr.5325s0057.1.p|Boechera_stricta|MYB_related|Bostr.5325s0057.1.p
    ATGGATACGCAGCGTAAGTCGAAGCATCTCAAGACCAATCCAACCATTGTTGCCTCTTCTTCTGAAGAAGTGAGCAGTCTTGAGTGGGAAGAAATAGCAATGGCTCAAGAAGAAGAGGATTTGATTTGCAGGATGTATAAGCTTGTCGGTGAAAGGTGGGATTTAATAGCTGGGAGGATTCCAGGAAGAACAGCTGAAGAGATCGAGAGGTTTTGGGTGATGAAGAATCATCGAAGATCTCAATTACGTTGA
Protein Sequence:
  • >Bostr.5325s0057.1.p|Boechera_stricta|MYB_related|Bostr.5325s0057.1.p
    MDTQRKSKHLKTNPTIVASSSEEVSSLEWEEIAMAQEEEDLICRMYKLVGERWDLIAGRIPGRTAEEIERFWVMKNHRRSQLR*