Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_023888409.1  — probable transcription factor At5g61620
  • Refseq:  XP_023888410.1  — probable transcription factor At5g61620
  • Swissprot:  Q9FKF9  — M5162_ARATH; Probable transcription factor At5g61620
  • TrEMBL:  A0A2I4GQ25  — A0A2I4GQ25_JUGRE; myb-like protein J
  • STRING:  VIT_11s0016g02410.t01  — (Vitis vinifera)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding
  • GO:0008270  — Molecular Function — zinc ion binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >augustus_masked-scaffold01226-abinit-gene-0.11-mRNA-1|Castanea_mollissima|MYB_related|augustus_masked-scaffold01226-abinit-gene-0.11-mRNA-1
Protein Sequence:
  • >augustus_masked-scaffold01226-abinit-gene-0.11-mRNA-1|Castanea_mollissima|MYB_related|augustus_masked-scaffold01226-abinit-gene-0.11-mRNA-1
    MARKCSHCGNMGHNSRTCNTRKRSGNFRLFGVQLDISSSSSFSPSFVMRKSFSMECLPSSSTTSSSSSSILAMDEKFDQVCNGYVSDGLIARNQERKKGMPWTEEEHHMFLVGLEKLGKGDWRGISRKFVTTKTPTQVASHAQKYFLRHNNHNKRKRRPSLFDLGRNNFRPQLVNSCVFNPSSEAASVSFEFPSKRTNTKVLDHGKVGYSEWPSSTNYSMPISFHNNIVESLPAHAASGLTTKLTLHTSKCNP