Gene Details:

  • Gene ID: AT5G53200.1
  • Gene Name: MFH8.14, TRY
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Arabidopsis thaliana
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_200132.2  — Homeodomain-like superfamily protein
  • Swissprot:  Q8GV05  — TRY_ARATH; Transcription factor TRY
  • TrEMBL:  A0A178UFU9  — A0A178UFU9_ARATH; TRY
  • STRING:  AT5G53200.1  — (Arabidopsis thaliana)

Gene Ontology:

  • GO:0006357  — Biological Process — regulation of transcription from RNA polymerase II promoter
  • GO:0007275  — Biological Process — multicellular organism development
  • GO:0010091  — Biological Process — trichome branching
  • GO:0005634  — Cellular Component — nucleus
  • GO:0000981  — Molecular Function — RNA polymerase II transcription factor activity, sequence-specific DNA binding
  • GO:0001135  — Molecular Function — transcription factor activity, RNA polymerase II transcription factor recruiting
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >AT5G53200.1|Arabidopsis_thaliana|MYB_related|AT5G53200.1
    ATGGATAACACTGACCGTCGTCGCCGTCGTAAGCAACACAAAATCGCCCTCCATGACTCTGAAGAAGTGAGCAGTATCGAATGGGAGTTTATCAACATGACTGAACAAGAAGAAGATCTCATCTTTCGAATGTACAGACTTGTCGGTGATAGGTGGGATTTGATAGCAGGAAGAGTTCCTGGAAGACAACCAGAGGAGATAGAGAGATATTGGATAATGAGAAACAGTGAAGGCTTTGCTGATAAACGACGCCAGCTTCACTCATCTTCCCACAAACATACCAAGCCTCACCGTCCTCGCTTTTCTATCTATCCTTCCTAG
Protein Sequence:
  • >AT5G53200.1|Arabidopsis_thaliana|MYB_related|AT5G53200.1
    MDNTDRRRRRKQHKIALHDSEEVSSIEWEFINMTEQEEDLIFRMYRLVGDRWDLIAGRVPGRQPEEIERYWIMRNSEGFADKRRQLHSSSHKHTKPHRPRFSIYPS