Gene Details:
- Gene ID: AT4G01060.2
- Gene Name: CPL3, ETC3
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Arabidopsis thaliana
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: NP_974493.1 — CAPRICE-like MYB3
- Swissprot: Q9M157 — ETC3_ARATH; MYB-like transcription factor ETC3
- TrEMBL: F4JHR9 — F4JHR9_ARATH; CAPRICE-like MYB3
- STRING: AT4G01060.1 — (Arabidopsis thaliana)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009651 — Biological Process — response to salt stress
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010026 — Biological Process — trichome differentiation
- GO:0010228 — Biological Process — vegetative to reproductive phase transition of meristem
- GO:0048765 — Biological Process — root hair cell differentiation
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >AT4G01060.2|Arabidopsis_thaliana|MYB_related|AT4G01060.2
ATGGATAACCATCGCAGGACTAAGCAACCCAAGACCAACTCCATCGTTACTTCTTCTTCTGAAGTGAGTAGTCTTGAGTGGGAAGTTGTGAACATGAGTCAAGAAGAAGAAGATTTGGTCTCTCGAATGCATAAGCTTGTCGGTGACAGGTGGGAACTGATAGCTGGGAGGATCCCAGGAAGAACCGCTGGAGAAATTGAGAGGTTTTGGGTCATGAAAAATTGA
Protein Sequence:
- >AT4G01060.2|Arabidopsis_thaliana|MYB_related|AT4G01060.2
MDNHRRTKQPKTNSIVTSSSEVSSLEWEVVNMSQEEEDLVSRMHKLVGDRWELIAGRIPGRTAGEIERFWVMKN