Gene Details:

  • Gene ID: AT2G30432.1
  • Gene Name: T6B20, TCL1
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Arabidopsis thaliana
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001031445.1  — Homeodomain-like superfamily protein
  • Swissprot:  D3GKW6  — TCL1_ARATH; MYB-like transcription factor TCL1
  • TrEMBL:  A0A178VV20  — A0A178VV20_ARATH; TCL1
  • STRING:  AT2G30432.1  — (Arabidopsis thaliana)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:2000039  — Biological Process — regulation of trichome morphogenesis
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >AT2G30432.1|Arabidopsis_thaliana|MYB_related|AT2G30432.1
    ATGGATAACACAAACCGTCTTCGCCGCCTTCACTGTCATAAACAACCCAAGTTCACTCATAGCTCTCAAGAAGTGAGTAGTATGAAATGGGAGTTTATCAATATGACCGAACAAGAAGAAGATCTCATCTTTAGAATGTACAGACTTGTTGGCGACAGGTGGGATTTAATAGCAAGAAGAGTGGTGGGACGTGAGGCAAAGGAGATAGAGAGATACTGGATTATGAGAAATTGTGACTATTTCTCCCACAAATGA
Protein Sequence:
  • >AT2G30432.1|Arabidopsis_thaliana|MYB_related|AT2G30432.1
    MDNTNRLRRLHCHKQPKFTHSSQEVSSMKWEFINMTEQEEDLIFRMYRLVGDRWDLIARRVVGREAKEIERYWIMRNCDYFSHK