Gene Details:
- Gene ID: AT1G01380.1
- Gene Name: ETC1, F6F3.18
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Arabidopsis thaliana
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: NP_171645.1 — Homeodomain-like superfamily protein
- Swissprot: Q9LNI5 — ETC1_ARATH; MYB-like transcription factor ETC1
- TrEMBL: A0A178WDR4 — A0A178WDR4_ARATH; ETC1
- STRING: AT1G01380.1 — (Arabidopsis thaliana)
Gene Ontology:
- GO:0006357 — Biological Process — regulation of transcription from RNA polymerase II promoter
- GO:0080147 — Biological Process — root hair cell development
- GO:1900033 — Biological Process — negative regulation of trichome patterning
- GO:0005634 — Cellular Component — nucleus
- GO:0000981 — Molecular Function — RNA polymerase II transcription factor activity, sequence-specific DNA binding
- GO:0001135 — Molecular Function — transcription factor activity, RNA polymerase II transcription factor recruiting
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0044212 — Molecular Function — transcription regulatory region DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >AT1G01380.1|Arabidopsis_thaliana|MYB_related|AT1G01380.1
ATGAATACGCAGCGTAAGTCGAAGCATCTTAAGACCAATCCAACCATTGTTGCCTCTTCTTCTGAAGAAGTGAGCAGTCTTGAGTGGGAAGAAATAGCAATGGCTCAGGAAGAAGAGGATTTGATTTGCAGGATGTATAAGCTTGTCGGTGAAAGGTGGGATTTAATAGCTGGGAGGATTCCAGGAAGAACAGCAGAAGAGATTGAGAGGTTTTGGGTGATGAAGAATCATCGAAGATCTCAATTACGTTGA
Protein Sequence:
- >AT1G01380.1|Arabidopsis_thaliana|MYB_related|AT1G01380.1
MNTQRKSKHLKTNPTIVASSSEEVSSLEWEEIAMAQEEEDLICRMYKLVGERWDLIAGRIPGRTAEEIERFWVMKNHRRSQLR