Gene Details:
- Gene ID: Araha.11664s0005.1.p
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Arabidopsis halleri
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_002892067.1 — MYB-like transcription factor ETC1
- Swissprot: Q9LNI5 — ETC1_ARATH; MYB-like transcription factor ETC1
- TrEMBL: D7KQ81 — D7KQ81_ARALL; Predicted protein
- STRING: Al_scaffold_0001_92 — (Arabidopsis lyrata)
- STRING: Bostr.5325s0057.1.p — (Boechera stricta)
Gene Ontology:
- GO:0080147 — Biological Process — root hair cell development
- GO:1900033 — Biological Process — negative regulation of trichome patterning
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >Araha.11664s0005.1.p|Arabidopsis_halleri|MYB_related|Araha.11664s0005.1.p
ATGGATACGCAGCGTAAGTCGAAGCATCTCAAGACCAATCCAACCACTGTTGCCTCTTCTTCTGAAGAAGTGAGCAGTCTTGAGTGGGAAGAAATAGCAATGGCTCAAGAAGAAGAGGATTTGATTTGCAGGATGTATAAGCTTGTCGGTGAAAGGTGGGATTTAATAGCTGGGAGGATTCCAGGAAGAACAGCAGAAGAGATCGAGAGGTTTTGGGTGATGAAGAATCATCGGAGATCTCAATTACGTTGA
Protein Sequence:
- >Araha.11664s0005.1.p|Arabidopsis_halleri|MYB_related|Araha.11664s0005.1.p
MDTQRKSKHLKTNPTTVASSSEEVSSLEWEEIAMAQEEEDLICRMYKLVGERWDLIAGRIPGRTAEEIERFWVMKNHRRSQLR*