Gene Details:

  • Gene ID: Aradu.8U1PN
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Arachis duranensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_015958601.1  — MYB-like transcription factor ETC3
  • Refseq:  XP_016196430.1  — MYB-like transcription factor ETC3
  • Refseq:  XP_025645884.1  — MYB-like transcription factor ETC3
  • Refseq:  XP_025693909.1  — MYB-like transcription factor ETC3
  • Swissprot:  Q9M157  — ETC3_ARATH; MYB-like transcription factor ETC3
  • TrEMBL:  A0A444ZCN5  — A0A444ZCN5_ARAHY; Uncharacterized protein
  • STRING:  XP_004486159.1  — (Cicer arietinum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Aradu.8U1PN|Arachis_duranensis|MYB_related|Aradu.8U1PN
    ATGAGTGACTCCAATCATCATAGTACCACTGAAGCAAATACTGCTAGCTCTGACCAATTTGTGAAAGAGATGAGACAAGAGGAGGAGCCTACTATGTTGGAATTCTCCGAAGATGAGGAAGATCTTGTTGCCAGGATGTTTAGATTAGTTGGGAAGAGGTGGTCTCTTATCGCTGGGAGAATCCCTGGAAGAACAGCACAAGAGATTGAAAAATATTGGAGTTCAAAGTGCGCATTTCCCAGTGACCAATGCTCCTCCTCTGCATAA
Protein Sequence:
  • >Aradu.8U1PN|Arachis_duranensis|MYB_related|Aradu.8U1PN
    MSDSNHHSTTEANTASSDQFVKEMRQEEEPTMLEFSEDEEDLVARMFRLVGKRWSLIAGRIPGRTAQEIEKYWSSKCAFPSDQCSSSA