Gene Details:

  • Gene ID: Aan012561
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Artemisia annua
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_022022365.1  — transcription factor TRY-like
  • Swissprot:  O22059  — CPC_ARATH; Transcription factor CPC
  • TrEMBL:  A0A2Z0PRV3  — A0A2Z0PRV3_ARTAN; Tryptichon/caprice
  • STRING:  Aquca_037_00095.1  — (Aquilegia coerulea)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Aan012561|Artemisia_annua|MYB_related|gnl|UG|Aan#S55081903
    ATGGATAAACGTTCAAGGAAGAACACTAGATCCTCCATGAACAACAATGGCGAGTTTGAAGAAGTGAGTAGTCGACAATGGGAGATCGTTGACCTGAGCCCAGCAGAAGAAGATTTGTTTTACAGGATGCACAAGCTTCTTGGTAACAGATGGGAATTGATAGCTGGCAGGATTCCAGGCCGAACTCCAGAAGAAATAGAGAGGTTTTGCCTAATGAGACATAGTGAAGTATTCAGTGACTTGAGGAAAAGAACCAAATCTTAA
Protein Sequence:
  • >Aan012561|Artemisia_annua|MYB_related|gnl|UG|Aan#S55081903
    MDKRSRKNTRSSMNNNGEFEEVSSRQWEIVDLSPAEEDLFYRMHKLLGNRWELIAGRIPGRTPEEIERFCLMRHSEVFSDLRKRTKS