Gene Details:

  • Gene ID: AA32G00127
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Aethionema arabicum
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_192015.2  — CAPRICE-like MYB3
  • Refseq:  XP_006396306.1  — MYB-like transcription factor ETC3 isoform X1
  • Refseq:  XP_024009863.1  — MYB-like transcription factor ETC3 isoform X2
  • Swissprot:  O22059  — CPC_ARATH; Transcription factor CPC
  • TrEMBL:  A0A178UVB0  — A0A178UVB0_ARATH; ETC3
  • STRING:  AT4G01060.1  — (Arabidopsis thaliana)
  • STRING:  XP_006396306.1  — (Eutrema salsugineum)

Gene Ontology:

  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0010026  — Biological Process — trichome differentiation
  • GO:0010228  — Biological Process — vegetative to reproductive phase transition of meristem
  • GO:0048765  — Biological Process — root hair cell differentiation
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >AA32G00127|Aethionema_arabicum|MYB_related|AA32G00127
    ATGGATAAACAACGAAGGACGAAGCAACTCAAGAACAAGAACAAACTCAATGCTACGTCTACTTCATCTCAAGCAGAAGTGAGCAGTATTGAGTGGGAAGTAGTGAAGCTGAGTGAAGAAGAAGAAGATTTGGTGTTTAGAATGTTTAAGCTTGTCGGTGACAGGTGGGATTTAATAGCTGGGAGGATCCCTGGAAGGACAGCACAAGAAATCGAGAGGTTTTGGGTCATGAAGAATAAT
Protein Sequence:
  • >AA32G00127|Aethionema_arabicum|MYB_related|AA32G00127
    MDKQRRTKQLKNKNKLNATSTSSQAEVSSIEWEVVKLSEEEEDLVFRMFKLVGDRWDLIAGRIPGRTAQEIERFWVMKNN