Gene Details:
- Gene ID: AA32G00127
- Gene Family: MYB_related Family
- Description: MYB_related Family protein
- Species: Aethionema arabicum
- Source: MYB_related family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:4.10.60.10
- PROSITE profile: PS51294
- SuperFamily: SSF46689
- TIGRFAMs: TIGR01557
- SMART: SM00717
- Gene3D: G3DSA:1.10.10.60
- Pfam: PF00249
- InterPro: IPR001878 IPR017930 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: NP_192015.2 — CAPRICE-like MYB3
- Refseq: XP_006396306.1 — MYB-like transcription factor ETC3 isoform X1
- Refseq: XP_024009863.1 — MYB-like transcription factor ETC3 isoform X2
- Swissprot: O22059 — CPC_ARATH; Transcription factor CPC
- TrEMBL: A0A178UVB0 — A0A178UVB0_ARATH; ETC3
- STRING: AT4G01060.1 — (Arabidopsis thaliana)
- STRING: XP_006396306.1 — (Eutrema salsugineum)
Gene Ontology:
- GO:0009651 — Biological Process — response to salt stress
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010026 — Biological Process — trichome differentiation
- GO:0010228 — Biological Process — vegetative to reproductive phase transition of meristem
- GO:0048765 — Biological Process — root hair cell differentiation
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.
Literature:
- A novel leaf-specific myb-related protein with a single binding repeat. DOI: 10.1016/s0378-1119(96)00521-5 ; PMID: 8996094
Sequences:
CDS Sequence:
- >AA32G00127|Aethionema_arabicum|MYB_related|AA32G00127
ATGGATAAACAACGAAGGACGAAGCAACTCAAGAACAAGAACAAACTCAATGCTACGTCTACTTCATCTCAAGCAGAAGTGAGCAGTATTGAGTGGGAAGTAGTGAAGCTGAGTGAAGAAGAAGAAGATTTGGTGTTTAGAATGTTTAAGCTTGTCGGTGACAGGTGGGATTTAATAGCTGGGAGGATCCCTGGAAGGACAGCACAAGAAATCGAGAGGTTTTGGGTCATGAAGAATAAT
Protein Sequence:
- >AA32G00127|Aethionema_arabicum|MYB_related|AA32G00127
MDKQRRTKQLKNKNKLNATSTSSQAEVSSIEWEVVKLSEEEEDLVFRMFKLVGDRWDLIAGRIPGRTAQEIERFWVMKNN