Information report for XP_016498669.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_009628670.1 — PREDICTED: myb-related protein 306
- Refseq: XP_016498669.1 — PREDICTED: myb-related protein 306-like
- Swissprot: B3VTV7 — MYB60_VITVI; Transcription factor MYB60
- TrEMBL: A0A1S4CCI6 — A0A1S4CCI6_TOBAC; myb-related protein 306-like
- STRING: XP_009628670.1 — (Nicotiana tomentosiformis)
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009416 — Biological Process — response to light stimulus
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010118 — Biological Process — stomatal movement
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_18047
- Juglans regia: WALNUT_00011695-RA
- Lotus japonicus: Lj1g3v4012910.1
- Manihot esculenta: Manes.09G135700.1.p
- Nicotiana benthamiana: Niben101Scf07438g03001.1, Niben101Scf00054g00013.1
- Populus trichocarpa: Potri.019G045900.1, Potri.013G067500.1
- Prunus mume: XP_008240570.1
- Prunus persica: Prupe.7G018400.1.p
- Pyrus bretschneideri: Pbr016839.1
- Salvia miltiorrhiza: SMil_00010264-RA_Salv
- Solanum lycopersicum: Solyc10g081490.1.1
- Solanum melongena: Sme2.5_00097.1_g00008.1
- Solanum tuberosum: PGSC0003DMP400048867
- Ziziphus jujuba: XP_015899725.1
Sequences
CDS Sequence:
- >XP_016498669.1|Nicotiana_tabacum|MYB|XP_016498669.1
ATGGGAAGGCCTCCTTGTTGTGACAAAATAGGTATAAAGAAAGGTCCTTGGACTCCTGAAGAAGATATTGTTTTGGTCTCTTATATTCAAGAACATGGTCCTGGAAATTGGAGATCAGTCCCTACTAATACTGGGTTGATGAGGTGCAGCAAAAGTTGCAGGCTAAGGTGGACAAATTACTTGAGGCCAGGAATCAAAAGGGGTAATTTCACTCCACATGAAGAAGGAATGATTGTCCATCTTCAAGCTTTATTGGGTAACAAATGGGCAGCCATAGCATCATATCTACCACAAAGGACAGACAATGACATAAAGAACTATTGGAACACTCATCTAAAGAAAAAGCTCAAGAAATTCCAAACAGGTTTGGATTCACATTTGAGTACTCCTCCTGCAGATTCTAGCACTTGTGATCATTTTTCATGGAATTTCATGAGTGACAATAATAAGCAAGGCTCAAAGTTATTACTACAACAGAACCACAACTCTCCAAATTCTTCCTCTTCCTTTTATGCTTCAAGTACTGAGAATATTTCAAGACTTTTAGAAGGTTGGATGAGATCTTCTCCAAACCCTTCTAGAAAAGTTGATGAAATGATTTTGCATGAAAATCAAAATAGCCAAGATCAAGACCTATTTAAAAGCCGTGAAACTTCTCTGGTTCAGGATGGAGGAATTAGCAACGGTATTAAAACAATTCCAAAAGAATACATGTCTGTTATTTCAGATATATCAGCTTGTGAAAGCAGTGGAGTTGCTGAAAAGACAATGAATACTAATACCCCTCCTCCATTCACATATCTTGAAAAGTGGCTGCTTGAAGAAAATGCTGGTCAAGTTGAAGAACTTATGGAACTTCCTATGATATTCACTTAA
Protein Sequence:
- >XP_016498669.1|Nicotiana_tabacum|MYB|XP_016498669.1
MGRPPCCDKIGIKKGPWTPEEDIVLVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYLRPGIKRGNFTPHEEGMIVHLQALLGNKWAAIASYLPQRTDNDIKNYWNTHLKKKLKKFQTGLDSHLSTPPADSSTCDHFSWNFMSDNNKQGSKLLLQQNHNSPNSSSSFYASSTENISRLLEGWMRSSPNPSRKVDEMILHENQNSQDQDLFKSRETSLVQDGGISNGIKTIPKEYMSVISDISACESSGVAEKTMNTNTPPPFTYLEKWLLEENAGQVEELMELPMIFT