Information report for XP_010906239.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_010906239.1 — transcription repressor MYB5-like
- TrEMBL: A0A2H3X621 — A0A2H3X621_PHODC; transcription factor WER-like
- STRING: XP_008778866.1 — (Phoenix dactylifera)
- GO:0009957 — Biological Process — epidermal cell fate specification
- GO:0010090 — Biological Process — trichome morphogenesis
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0048481 — Biological Process — plant ovule development
- GO:0048629 — Biological Process — trichome patterning
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Citrullus lanatus: Cla012581
- Cucumis sativus: Cucsa.340790.2
- Fragaria vesca: mrna07418.1-v1.0-hybrid
- Gossypium arboreum: Cotton_A_18382_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A08G1517, GhMYB66, Gh_D08G1815
- Malus domestica: MDP0000253904, MDP0000133817
- Manihot esculenta: Manes.01G083100.1.p, Manes.01G083100.3.p
- Musa acuminata: GSMUA_Achr2P17960_001, GSMUA_Achr11P23500_001, GSMUA_Achr8P14540_001, GSMUA_Achr4P21700_001
- Populus trichocarpa: Potri.001G169600.1
- Pyrus bretschneideri: Pbr015228.1
Sequences
CDS Sequence:
- >XP_010906239.1|Elaeis_guineensis|MYB|XP_010906239.1
ATGGTGAAGAAGACAGAGAGAGTAGGGAAGAAGGGGGTGGTGATGGTAAACAAAGGGGCATGGACTGCTGAGGAGGACCAGAAACTTGTAGACTACATTAGAACTCATGGTGACAAGAAGTGGAGAACTCTCCCTGCCAAAGCTGGGCTTAATAGGTGTGGGAAGAGCTGCAGGTTGAGATGGCTGAACTATCTGAGGCCTGGGATAAAAAGAGGGAATATATCTGAAGATGAAGAGGATCTCATTATTCGACTCCACAACCTCCTGGGCAACAGATGGTCTCTAATTGCTGGAAGATTGCCTGGCCGGACAGACAACGAGATAAAGAACCACTGGAATACTCACTTGAGCAAACAGACATTAACGATCGATGATCTAAACCTTAAGCTGAACACGAAACATGAGGGTGTTCATGGCCATTCTCACCCATCAAACAATCCTCTCGGACCAATGCAGGGGTTCAAGCCAACAATCTCGGAGGAGCACTTCGAAGCTTGGCTCCCGGAAAACAATGACGAGTTGGTAAGCTCATGGGTTGACTTGCCTGTGTCCGAATTTGACGTTGAGCAGCTCTTTGACTTCACGTCGATGCTGGATGTTGAGGGGAACGAGGGTGGAAGCAGTGGCAGTGAGCTGGGAGTAGAAGATTATGGCATGACGCATCAAGATGGTTGCCAGGAGCCCATCAAGAATGATCTTTGCGGAGTAAACAGTCAGGGGTCTTTGGACCCACAGGCTATGTGCAATCCATTAGAGTTTGATGATTTTGACCAGTTCATTGGTTGTCAGGACTATGAATTATATTTTTTTCACTAA
Protein Sequence:
- >XP_010906239.1|Elaeis_guineensis|MYB|XP_010906239.1
MVKKTERVGKKGVVMVNKGAWTAEEDQKLVDYIRTHGDKKWRTLPAKAGLNRCGKSCRLRWLNYLRPGIKRGNISEDEEDLIIRLHNLLGNRWSLIAGRLPGRTDNEIKNHWNTHLSKQTLTIDDLNLKLNTKHEGVHGHSHPSNNPLGPMQGFKPTISEEHFEAWLPENNDELVSSWVDLPVSEFDVEQLFDFTSMLDVEGNEGGSSGSELGVEDYGMTHQDGCQEPIKNDLCGVNSQGSLDPQAMCNPLEFDDFDQFIGCQDYELYFFH