Information report for XP_010089050.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_010089050.1 — transcription factor MYB86
- TrEMBL: W9QPH0 — W9QPH0_9ROSA; Transcription factor
- STRING: XP_010089050.1 — (Morus notabilis)
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:1901430 — Biological Process — positive regulation of syringal lignin biosynthetic process
- GO:2000652 — Biological Process — regulation of secondary cell wall biogenesis
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_13642, C.cajan_13238
- Glycine max: Glyma.01G222200.1.p
- Gossypium arboreum: Cotton_A_39594_BGI-A2_v1.0
- Gossypium hirsutum: Gh_D08G1266, Gh_A08G0993
- Manihot esculenta: Manes.01G057200.1.p
- Populus trichocarpa: Potri.003G132000.1, Potri.003G132000.3, Potri.003G132000.2, Potri.001G099800.1
- Prunus mume: XP_008238950.1
- Prunus persica: Prupe.5G105700.1.p
- Pyrus bretschneideri: Pbr038701.2, Pbr002239.1
- Ricinus communis: 30190.m011268
- Vitis vinifera: GSVIVT01019410001
- Ziziphus jujuba: XP_015896504.1
Sequences
CDS Sequence:
- >XP_010089050.1|Morus_notabilis|MYB|XP_010089050.1
ATGGGTCACCACTCTTGCTGCAACCAACAGAAGGTTAAGAGAGGACTTTGGTCTCCTGAAGAAGATGAGAAGCTCATCAGATACATCACCACCCATGGCTATGGCTGCTGGAGTGAAGTTCCTGAGAAAGCAGGGCTTCAAAGGTGTGGTAAGAGTTGTCGTTTGAGATGGATTAATTATTTGAGGCCTGATATTAGAAGAGGCAGATTCACTCCGGAGGAGGAGAAGTTGATTATTAGCCTTCATGGGGTTGTGGGGAACAGATGGGCTCACATAGCCAGTCACCTACCCGGTAGAACAGACAATGAGATAAAAAACTACTGGAACTCATGGATCAAGAAGAAGATAAGAAAACCGTCTTCCACACCTTCGACGACGGGCATTACCGCAACACCGCCTAGTAGCACAGATCATCATCCTCAAATGTGTTACAACATGACAAACCAACTAGACTTCCTAACACAAGATTTGACCAAGCCTAATACCGCGGTCCAAGACCACCAAGCTCTTTTCTCATCTTCATGGCCTCTATTCATGTTTGACACCGCAGCTATTGAAGCGGCCACGGATAGCACTACTACTACTACCACTACTACTACTAACACGTTGCGTGGAGAGCTCTTTCAAGACATTCTAACAATGGGAAATTTGAGCTCCGACACGATAACATCGTCGTCGCCGTCGTCGTGGAATCTGAACCAACACCAAGTCCAAGCACTGCCTCCTAATTCACTGGTGGTGCCACCATTTTCAAGTGCTACTATGAACATTAGCTACTTGCCTCCTTTGATAGAGAACATGGACAACATGGTTCACGTCGAAGAAGGCGATCAAATCGCTTTGGATTGCTTGCAGAGACAGGAATTGATGAACGAGTGGGTTGAATCCCAACAAGCGCAATGCTCAAACAATTTTCTTTTCTGGGAAAATGTCGTGGTCGAATCGGGGTCGCTTGGCGTGGGAGAAAGTAACATTAATATTAACGCACCAACATCTTCGTCCAATTTGGGAGTGTCTTCTTTTCCTAATTCGTCTCTATAA
Protein Sequence:
- >XP_010089050.1|Morus_notabilis|MYB|XP_010089050.1
MGHHSCCNQQKVKRGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYLRPDIRRGRFTPEEEKLIISLHGVVGNRWAHIASHLPGRTDNEIKNYWNSWIKKKIRKPSSTPSTTGITATPPSSTDHHPQMCYNMTNQLDFLTQDLTKPNTAVQDHQALFSSSWPLFMFDTAAIEAATDSTTTTTTTTTNTLRGELFQDILTMGNLSSDTITSSSPSSWNLNQHQVQALPPNSLVVPPFSSATMNISYLPPLIENMDNMVHVEEGDQIALDCLQRQELMNEWVESQQAQCSNNFLFWENVVVESGSLGVGESNININAPTSSSNLGVSSFPNSSL