Information report for XP_010087725.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_010087725.1 — transcription factor MYB26
- TrEMBL: W9QL64 — W9QL64_9ROSA; Transcription factor
- STRING: XP_010087725.1 — (Morus notabilis)
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009834 — Biological Process — plant-type secondary cell wall biogenesis
- GO:0009901 — Biological Process — anther dehiscence
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_00477
- Cicer arietinum: XP_004510395.1
- Citrullus lanatus: Cla012590
- Glycine max: Glyma.07G008500.1.p, Glyma.08G191500.1.p
- Juglans regia: WALNUT_00004179-RA
- Lotus japonicus: Lj3g3v0323350.1
- Malus domestica: MDP0000148894
- Manihot esculenta: Manes.11G024700.1.p, Manes.04G140800.1.p
- Populus trichocarpa: Potri.001G197000.1
- Prunus mume: XP_008228386.1
- Prunus persica: Prupe.3G046900.1.p
- Pyrus bretschneideri: Pbr026154.1, Pbr026151.1, Pbr026146.1, Pbr032003.1, Pbr015283.1
Sequences
CDS Sequence:
- >XP_010087725.1|Morus_notabilis|MYB|XP_010087725.1
ATGGGACACCACTCATGTTGCAACAAACAGAAGGTGAAGAGAGGGCTTTGGTCACCAGAGGAAGATGAGAAACTCATCAACTACATTTCAACCTACGGCCATGGCTGTTGGAGCTCTGTTCCAAAACTTGCAGGCCTACAAAGATGTGGAAAGAGTTGCAGACTAAGATGGATAAACTATCTAAGACCTGACCTCAAACGTGGAAGCTTCTCTCCCCAAGAAGCTGCCCTCATCATTGAACTCCATAGCATTCTAGGCAACAGGTGGGCTCAGATAGCAAAGCACCTACCGGGAAGAACAGACAATGAGGTGAAGAATTTTTGGAACTCAAGCATAAAGAAGAAGATCCTGTCCCATCATGATCATCATCACTCTTTTGTTGATCATCACATTCATTTCCCCACTACTACCGTTAATCCCAACGAGGCCAATTTCTTCACTTTCACTGCAAACCCTAGTTTGATCCTCGCCGCGGCCTCTCAACAAGATAATCATCATCATCAAGAGCTATACCTACCCTGCAGCATGATCGACAATAATATGATTAATCCAACGGCAGTGCCTGATCAGGGACTGTTTTACCACAACGATCATCTCAAACTAGACCAGACGAACTTCAACTCTAATATTATTGATCAGGCCGTTCGTCTTCCATCATTCAACATATCGTCAACGGTTGTTAATAACCCATCAATATCTACGTATGATTCCACGTGGTTGCTAGGCCAGCAAAGTACTACTGCTACTGCTACTAGTACTACTCCGCAGTTTGATTATACGGCCAATATTAATCAACGAGCTGATCATCATGATCAGAGTACTCTCATGGTTGCTCCAAATATCTATGACAATTCTCTCGGCGGTGGTGACAAACTCATCGATCCAAGTTCGATTTTATCAGCTTATGAAAGCGCATTAATGGCTCCCACGTCCATGATACCAAAACTCTGTGATATCGGTAACAATGTTGACGGTAACTTCTGCTTGGTGCCTCCATGTTCATCTTCTCCGCAATTAGCAGAATTAGTTCCATTGAACGTTGATTCTATGATCATTAAGCCGTCGTCGTTAGTACCATTGACTCCTTTGTCATCACCTTTATCCTCGTCGTCTCCCTCATCGTGCTTGTCATCATTGTCGCCGATATCTAACGGCCAATTTGTCAATCTGAAGCCATGA
Protein Sequence:
- >XP_010087725.1|Morus_notabilis|MYB|XP_010087725.1
MGHHSCCNKQKVKRGLWSPEEDEKLINYISTYGHGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLKRGSFSPQEAALIIELHSILGNRWAQIAKHLPGRTDNEVKNFWNSSIKKKILSHHDHHHSFVDHHIHFPTTTVNPNEANFFTFTANPSLILAAASQQDNHHHQELYLPCSMIDNNMINPTAVPDQGLFYHNDHLKLDQTNFNSNIIDQAVRLPSFNISSTVVNNPSISTYDSTWLLGQQSTTATATSTTPQFDYTANINQRADHHDQSTLMVAPNIYDNSLGGGDKLIDPSSILSAYESALMAPTSMIPKLCDIGNNVDGNFCLVPPCSSSPQLAELVPLNVDSMIIKPSSLVPLTPLSSPLSSSSPSSCLSSLSPISNGQFVNLKP