Information report for XP_009801248.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_009801248.1 — PREDICTED: protein ODORANT1-like
- Refseq: XP_016465732.1 — PREDICTED: protein ODORANT1-like
- Swissprot: Q9LDR8 — MY102_ARATH; Transcription factor MYB102
- TrEMBL: A0A1S3ZMZ6 — A0A1S3ZMZ6_TOBAC; protein ODORANT1-like
- TrEMBL: A0A1U7YDP8 — A0A1U7YDP8_NICSY; protein ODORANT1-like
- STRING: XP_009801248.1 — (Nicotiana sylvestris)
- GO:0009611 — Biological Process — response to wounding
- GO:0009651 — Biological Process — response to salt stress
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Capsicum annuum: CA02g16960
- Fragaria vesca: mrna30725.1-v1.0-hybrid
- Gossypium arboreum: Cotton_A_04729_BGI-A2_v1.0
- Gossypium hirsutum: Gh_D05G1585, Gh_Sca004734G04
- Manihot esculenta: Manes.16G019700.1.p, Manes.17G033800.1.p
- Nicotiana benthamiana: Niben101Scf04122g03021.1, Niben101Scf01529g00012.1
- Nicotiana tabacum: XP_016465732.1, XP_016466799.1, XP_016436111.1
- Populus trichocarpa: Potri.004G033100.1
- Sesamum indicum: XP_011096186.1
- Solanum lycopersicum: Solyc02g079280.2.1
- Solanum melongena: Sme2.5_01578.1_g00007.1
- Solanum tuberosum: PGSC0003DMP400038822
Sequences
CDS Sequence:
- >XP_009801248.1|Nicotiana_sylvestris|MYB|XP_009801248.1
ATGGGAAGAGCTCCTTGTTGTGACAAAAATGGACTTAAGAAGGGTCCATGGACCCCTGAAGAAGATCAAAAGCTCATTGATTACATTCAAAAACATGGCTATGGAAATTGGAGAACTCTTCCAAAGAATGCTGGACTTCAAAGGTGTGGAAAGAGTTGCAGGCTTCGTTGGACAAACTATCTAAGGCCAGATATTAAAAGGGGAAGGTTCTCTTTTGAAGAAGAAGAGACAATCATTCAACTGCATAGTGTTTTAGGGAACAAGTGGTCTGCTATTGCTGCGCGTTTGCCCGGTAGAACTGATAATGAAATCAAGAACTATTGGAACACTCACATCAGAAAAAGGCTTTTGAGAATGGGAATTGATCCAGTAACTCATAGTCCACGCCTTGATCTTCTTGATCTTTCTTCCATTTTAAACCCTTCACTCTACCATTCATCTCATCAAATGAATCTTTCAAGATTGTTTGGTCATGTCCAATCATTGGTAAATCCTGAAGTTTTGAGATTAGCTACTTCTCTTTTATCCTCACAACGCCAAAACTCTAACTTTTTAATGCCAAATAATCTTCAAGAAAATCAAATATGCAATCCTCAAGTCCAAAACCAATTGCCACAAATGGTCCAAATTACTAGCCAAGTTCAAAACCCTATTCAAGATATTCCAACTTGCACCACTTTATGTACTACTTCATGTGTTCCATTTTCAAGTGAAGCTCAACTCATGCAGCCACCTACAAATATGGAACAATTCTCATCAAATCTTGAAAACTTTAGCTCACAAAATTGCCAAGTAAATGAGTGGCAAAGCAATGGGGTTCCTTCAAATTTGACTGATGATTATTTTGCTGTACAAAATTATGGGTACTATCATGAGGTGGATCAGTCCATCAGGGATCCTCCACCGTCCGATGCTTCAACATTTCAATCCAACGATAGCAACAACTTCAGCTTTCAATCTGTTTTGTCTAATTTATCGACGCCTTCATCAAGTCCCACGCCATTGAATTCAAACTCAACTTACTTCAACAACAGCAGCAGCACAACTGAAGATGAGAGAGATAGCTACTGCAGCAACGTGTTGAACTTTGATATCCCAAATATTTGGGATTCCACTAATGAATTTATGTAA
Protein Sequence:
- >XP_009801248.1|Nicotiana_sylvestris|MYB|XP_009801248.1
MGRAPCCDKNGLKKGPWTPEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYLRPDIKRGRFSFEEEETIIQLHSVLGNKWSAIAARLPGRTDNEIKNYWNTHIRKRLLRMGIDPVTHSPRLDLLDLSSILNPSLYHSSHQMNLSRLFGHVQSLVNPEVLRLATSLLSSQRQNSNFLMPNNLQENQICNPQVQNQLPQMVQITSQVQNPIQDIPTCTTLCTTSCVPFSSEAQLMQPPTNMEQFSSNLENFSSQNCQVNEWQSNGVPSNLTDDYFAVQNYGYYHEVDQSIRDPPPSDASTFQSNDSNNFSFQSVLSNLSTPSSSPTPLNSNSTYFNNSSSTTEDERDSYCSNVLNFDIPNIWDSTNEFM