Information report for XP_009794316.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_009794315.1 — PREDICTED: transcription factor DIVARICATA-like
- Refseq: XP_009794316.1 — PREDICTED: transcription factor DIVARICATA-like
- Refseq: XP_016498888.1 — PREDICTED: transcription factor DIVARICATA-like
- Swissprot: Q8S9H7 — DIV_ANTMA; Transcription factor DIVARICATA
- TrEMBL: A0A1S4CCL4 — A0A1S4CCL4_TOBAC; transcription factor DIVARICATA-like
- TrEMBL: A0A1U7Y696 — A0A1U7Y696_NICSY; transcription factor DIVARICATA-like
- STRING: XP_009794315.1 — (Nicotiana sylvestris)
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Capsicum annuum: CA06g25110
- Gossypium arboreum: Cotton_A_12918_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A05G0757, Gh_D05G0887
- Nicotiana benthamiana: Niben101Scf02250g00006.1, Niben101Scf06189g02007.1
- Nicotiana tabacum: XP_016498888.1, XP_016432478.1
- Petunia inflata: Peinf101Scf02316g00011.1, Peinf101Scf02272g00040.1
- Populus trichocarpa: Potri.001G248800.2, Potri.001G248800.1, Potri.009G042600.1
- Sesamum indicum: XP_011080854.1
- Solanum lycopersicum: Solyc06g076770.2.1
- Solanum melongena: Sme2.5_00021.1_g00013.1
- Solanum tuberosum: PGSC0003DMP400052826
- Ziziphus jujuba: XP_015896949.1
Sequences
CDS Sequence:
- >XP_009794316.1|Nicotiana_sylvestris|MYB|XP_009794316.1
ATGGAGATTTTATCACCAGCTCCTTATCTTTCAAATTCAAGCTGGTTTCTTGATGAGGAAAGGAGCACAAAATGGACTCCAGCTGAGAATAAGGCATTTGAGAATGCTCTTGCCTTGTTTGATAAAGATACACCAGATAGATGGCAAAGGGTAGCAGAAATGGTTCCAGGGAAAACAGTTGTTGATGTAATTAGGCAATATAAGGAATTAGAAGATGATGTGAGCAGGATAGAAGCTGGATTAATTACTATTCCTGGTTATACTACTACTTCTTCTTCTTCCTCTTCTTCTTCACCTTTTACATTAGAATGGGGGAATAGTCATAACAGCTTTGATGGATACAAGCAGTCTTATGTTGTTGGAGGCAAAAGATCTTTGTCCAATAGGCCTCCAGAACAAGAGAGGAAGAAGGGTATTCCATGGACAGAGGAAGAACATAAGTTGTTTCTAATGGGGCTTAAAAAGTATGGAAAAGGCGATTGGAGGAATATCTCGCGAAATTTCGTTATTACTAGAACCCCAACTCAAGTCGCAAGTCATGCTCAGAAGTACTTTATCAGACAACTTTCGGGTGGCAAAGATAAAAGACGCGCCAGCATTCATGACATTACAACAATAAATCTCAACGATAATCAAATGCCTTCACCGGATCACCAAAAACCAACTCCAATCGATCAATCCACTGTGATTTCCCAGCAACCAAAATCGGCTGACAATGCCATGCACAAAATGCCATTTCAGTGGAGTCAGGTGAATAATGGCTTTAATTATGCAGAAGGAAGTTTGTTCATGTCTCCTCCTTATGGAGGTAACTCCTATGGGGACACTAAAATGCAAAGCCAAAGTCTGCAGCAAAGAGCTGCAATGCGTGAGCCTTACTTTGGATCTCAAAGTATGAATTTTCAGCTTCAATCGGCACAGCCTTACTATCATGCATGA
Protein Sequence:
- >XP_009794316.1|Nicotiana_sylvestris|MYB|XP_009794316.1
MEILSPAPYLSNSSWFLDEERSTKWTPAENKAFENALALFDKDTPDRWQRVAEMVPGKTVVDVIRQYKELEDDVSRIEAGLITIPGYTTTSSSSSSSSPFTLEWGNSHNSFDGYKQSYVVGGKRSLSNRPPEQERKKGIPWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKYFIRQLSGGKDKRRASIHDITTINLNDNQMPSPDHQKPTPIDQSTVISQQPKSADNAMHKMPFQWSQVNNGFNYAEGSLFMSPPYGGNSYGDTKMQSQSLQQRAAMREPYFGSQSMNFQLQSAQPYYHA