Information report for XP_009785597.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_009785597.1 — PREDICTED: myb-related protein 306-like
- Refseq: XP_016504410.1 — PREDICTED: myb-related protein 306-like
- Swissprot: P81392 — MYB06_ANTMA; Myb-related protein 306
- TrEMBL: A0A1S4CTG9 — A0A1S4CTG9_TOBAC; myb-related protein 306-like
- TrEMBL: A0A1U7X0B9 — A0A1U7X0B9_NICSY; myb-related protein 306-like
- STRING: XP_009785597.1 — (Nicotiana sylvestris)
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010468 — Biological Process — regulation of gene expression
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0080167 — Biological Process — response to karrikin
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Capsicum annuum: CA03g30090
- Nicotiana benthamiana: Niben101Scf12143g00001.1, Niben101Scf03482g02002.1, Niben101Scf07231g08006.1, Niben101Scf01908g01004.1, Niben101Scf03716g04008.1
- Nicotiana tabacum: XP_016504410.1, XP_016450803.1, XP_016452053.1, XP_016452464.1, XP_016500412.1, XP_016466348.1
- Solanum lycopersicum: Solyc03g116100.2.1
- Solanum melongena: Sme2.5_00669.1_g00015.1, Sme2.5_00298.1_g00007.1
- Solanum tuberosum: PGSC0003DMP400033945, PGSC0003DMP400055794
Sequences
CDS Sequence:
- >XP_009785597.1|Nicotiana_sylvestris|MYB|XP_009785597.1
ATGGGAAGGCCACCTTGTTGTGATAAAATAGGGGTGAAGAAAGGACCATGGACACCAGAAGAGGATATCATCTTGGTTTCATATATTCAACAACATGGTCCTGGTAACTGGAGAGCTGTTCCCAGTAATACTGGTTTGCTTAGATGCAGCAAGAGCTGTAGACTTAGATGGACTAATTATCTCCGTCCGGGAATCAAACGTGGCAACTTCACAGAACATGAAGAAAAGATGATTATTCACCTCCAAGCTCTTCTTGGCAACAGATGGGCTGCGATAGCATCATATCTTCCACAAAGGACGGACAACGATATAAAAAATTACTGGAATACTCATCTGAGAAAGAAGCTGAAGAAACTTCAAGGGAATGATGAAAATAGTAGTCAAGAGGGAATAAGCTCATCGTCTCAATCAAATGTCTCAAAAGGACAGTGGGAGAGGAGGCTTCAAACTGATATCCACATGGCTAAAAAAGCTCTTTGTGAGGCTTTGTCCCTTGACAAATCGAATTCTCCGCCAAATAATCCTATCCCTCAACCTGTTCAATCATCTTGTACTTATGCATCTAGTGCTGAAAATATTTCTCGATTGCTTCAAAATTGGATGAAAAATTCCCCCAAATCATCTCAATTTAGTCAATCAAACTCGGAGTGTACTACTCAAAGCTCCTTTAATAATTTATCAATCGGGCAGTCTTCTAGTCCTAGTGAAGGGACCATTAGTGCAACAACACCAGAGGGTTTTGATCCAATCTTTATGTCTCAATCGATGATGGCAGATGAGTGTAACGCTTTCACACCTGAAAATGCTGGGACTTTCCAAGTTGAAAGCAAGCCGAATTTGCCGAATCTGAATGCTGAAAATGGATTTTTATTTCAAGAGGAAAGCAAGCCGAATTTGGAATCGGAAGTTCCGTTAACGTTGCTGGAGAAGTGGCTGTTTGATGATGTTATTAATGCACCAGCACAAGAAGACCTAATGGGATTGGGAATGACCTTGGCCGATGCTGCTGACTTGTTTTGA
Protein Sequence:
- >XP_009785597.1|Nicotiana_sylvestris|MYB|XP_009785597.1
MGRPPCCDKIGVKKGPWTPEEDIILVSYIQQHGPGNWRAVPSNTGLLRCSKSCRLRWTNYLRPGIKRGNFTEHEEKMIIHLQALLGNRWAAIASYLPQRTDNDIKNYWNTHLRKKLKKLQGNDENSSQEGISSSSQSNVSKGQWERRLQTDIHMAKKALCEALSLDKSNSPPNNPIPQPVQSSCTYASSAENISRLLQNWMKNSPKSSQFSQSNSECTTQSSFNNLSIGQSSSPSEGTISATTPEGFDPIFMSQSMMADECNAFTPENAGTFQVESKPNLPNLNAENGFLFQEESKPNLESEVPLTLLEKWLFDDVINAPAQEDLMGLGMTLADAADLF