Information report for XP_009764613.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_009764613.1 — PREDICTED: myb-related protein 308-like
- Refseq: XP_016468960.1 — PREDICTED: myb-related protein 308-like
- Swissprot: P81393 — MYB08_ANTMA; Myb-related protein 308
- TrEMBL: A0A1S3ZWZ4 — A0A1S3ZWZ4_TOBAC; myb-related protein 308-like
- TrEMBL: A0A1U7VE24 — A0A1U7VE24_NICSY; myb-related protein 308-like
- STRING: XP_009764613.1 — (Nicotiana sylvestris)
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010224 — Biological Process — response to UV-B
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0090379 — Biological Process — secondary cell wall biogenesis involved in seed trichome differentiation
- GO:1903086 — Biological Process — negative regulation of sinapate ester biosynthetic process
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Capsicum annuum: CA10g08070
- Citrullus lanatus: Cla020285
- Cucumis melo: MELO3C020812P1
- Gossypium hirsutum: Gh_D01G1631
- Nicotiana benthamiana: Niben101Scf02658g03021.1
- Nicotiana tabacum: XP_016468960.1, XP_016437538.1, XP_016501430.1, XP_016512353.1, XP_016492622.1
- Pyrus bretschneideri: Pbr020733.1, Pbr020726.1
- Solanum lycopersicum: Solyc10g055410.1.1, Solyc01g111500.2.1
- Solanum melongena: Sme2.5_08041.1_g00002.1
- Solanum tuberosum: PGSC0003DMP400023376, PGSC0003DMP400010956
Sequences
CDS Sequence:
- >XP_009764613.1|Nicotiana_sylvestris|MYB|XP_009764613.1
ATGGGAAGGTCACCATGTTGTGAGAAGGCTCATACAAACAAAGGAGCTTGGACTAAAGAAGAAGATGAAAGACTTATTGCTTACATTAAAGCTCATGGTGAAGGTTGTTGGAGGTCTCTTCCTAAAGCTGCTGGCCTTCTCAGATGTGGTAAAAGTTGCCGTCTACGTTGGATTAATTACTTAAGACCTGATCTTAAACGTGGTAATTTCACTGAAGAAGAAGATGAACTCATTATCAAACTCCATAGCCTCCTTGGTAACAAGTGGTCACTTATAGCGGGAAGATTACCAGGAAGAACAGATAACGAGATAAAGAATTATTGGAACACACATATAAGAAGGAAGCTTTTGAGTAGGGGTATTGATCCAACAACACATAGGCTAATGAACGAACCTACTGGTACACAAAAAATGACAACCATTTGTTTTGCTGCTGATGATCAAGAACAGAAGATTAAGATCAAATCCGAATTAGTCGAGACGATGAGCAAGGAAGAAAAAGATCATGAAATTCAAGAACGGTGTCCTGATTTGAATCTTGAACTTAGAATCAGTCCTCCTCATAATCAACAAAACCAACTTGATCATAATCAAAGAGCAAATTCTTTGTGTTTTACATGTAGTTTGGGTATACAAAATAGTAAAGATTGCAGTTGCAGTAGTAAAAATAGTAATGGAAATGGCTGTAGTAATATTATAAGTATGAATATGAATATTTCTGGTTATGATTTTTTAGGGTTGAAGAATAATGGTCTTGTTTTGGACTATAGAACATTGGAAACTAAGTGA
Protein Sequence:
- >XP_009764613.1|Nicotiana_sylvestris|MYB|XP_009764613.1
MGRSPCCEKAHTNKGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRGIDPTTHRLMNEPTGTQKMTTICFAADDQEQKIKIKSELVETMSKEEKDHEIQERCPDLNLELRISPPHNQQNQLDHNQRANSLCFTCSLGIQNSKDCSCSSKNSNGNGCSNIISMNMNISGYDFLGLKNNGLVLDYRTLETK