Information report for XP_009764550.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_009764550.1 — PREDICTED: transcription factor WER
- TrEMBL: A0A1U7VRM8 — A0A1U7VRM8_NICSY; transcription factor WER
- STRING: XP_009764550.1 — (Nicotiana sylvestris)
- GO:0048658 — Biological Process — anther wall tapetum development
- GO:0052545 — Biological Process — callose localization
- GO:0055046 — Biological Process — microgametogenesis
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_35228
- Capsicum annuum: CA04g08580
- Daucus carota: DCAR_011175
- Lotus japonicus: Lj0g3v0129839.1
- Manihot esculenta: Manes.15G175900.1.p, Manes.17G023900.1.p
- Nicotiana benthamiana: Niben101Scf00339g03027.1, Niben101Scf02253g07014.1
- Nicotiana tabacum: XP_016441905.1, XP_016471810.1
- Prunus mume: XP_008230970.1
- Prunus persica: Prupe.3G274800.1.p
- Pyrus bretschneideri: Pbr026260.1
- Sesamum indicum: XP_011098554.1
- Solanum lycopersicum: Solyc03g059200.1.1
- Solanum melongena: Sme2.5_02316.1_g00005.1
- Solanum tuberosum: PGSC0003DMP400014987
- Vitis vinifera: GSVIVT01032564001
Sequences
CDS Sequence:
- >XP_009764550.1|Nicotiana_sylvestris|MYB|XP_009764550.1
ATGGGAAGGCCTCCTTGTTGTGATAAAGCAAATATCAAAAGAGGCCCGTGGACTGCTGAGGAAGATGCAAAAATTCTTGCTTATGTAGCCTCTCATGGAATTGGCAACTGGACGTTGGTCCCTCAGAAAGCAGGTCTCAATAGGTGTGGAAAAAGTTGTAGGCTCAGATGGACCAATTATCTACGCCCTGATCTTAAGCATGACAACTTCACACCTCAAGAAGAAGAGTGCATCCTTGAGCTTCACAAAACCATTGGTAGCAGGTGGTCTTTAATAGCAAAGCAATTACCTGGGAGAACAGATAATGACGTCAAAAATTACTGGAACACAAAACTCAAGAAAAAGCTTGTGAACATGGGAATTGATCCTGTAACACATAAACCATTTGCTCAAGTCTTTGCTGAGTATGGAAAAATCAGTGGCCTTCCAATTCAAAATACAAGAAATAATATCTGTTTGCCCAACAATACCACTGAAATATCAAAGCAATTTCCATTCTCAAGTGGAACTCCACATGACAAATTTGTTCACAACATTATGAATGATCAGTTACAAGAAAACTACTCCACTCAGAAATACACATGGGATCTTAAGCCTCAGTATCAAGTCATCCATGAGGAGACTCTTCAAACAAACAGTTTTAGTGAAGTCTCCCCCTTGATTTCATCAGCAACTTCTTTTAACCCAACAGTATTCAGCTCATCGTCTTCTTACGCTTCCGTGCAATCTCAGGTTCATACCACGGCATGTTCTTCGTCAACATCTACTTGGAACGAGTTTGTACTTGGAGATCTGTGTACATCCACAGATACAGAGCAAAAACAGGAATACCAACTCCAAGCTGGGATATATTTGTCAAAGGATCTGTCAAGTTCAGTTCACAAGGACAATCCCACTTGTGGGGAAGTGACTGAAGTTGAGGAAAAGCAATCTGTTGAAGAAACCACTTGTTCCTCTGCTGTGGATTCATTCGTGGACACTATCTTGGCTCGCGACAAGCAAATGCTAATGGATTTTCCTCCACTTCTAGATTTGTATCTTGATTATTGA
Protein Sequence:
- >XP_009764550.1|Nicotiana_sylvestris|MYB|XP_009764550.1
MGRPPCCDKANIKRGPWTAEEDAKILAYVASHGIGNWTLVPQKAGLNRCGKSCRLRWTNYLRPDLKHDNFTPQEEECILELHKTIGSRWSLIAKQLPGRTDNDVKNYWNTKLKKKLVNMGIDPVTHKPFAQVFAEYGKISGLPIQNTRNNICLPNNTTEISKQFPFSSGTPHDKFVHNIMNDQLQENYSTQKYTWDLKPQYQVIHEETLQTNSFSEVSPLISSATSFNPTVFSSSSSYASVQSQVHTTACSSSTSTWNEFVLGDLCTSTDTEQKQEYQLQAGIYLSKDLSSSVHKDNPTCGEVTEVEEKQSVEETTCSSAVDSFVDTILARDKQMLMDFPPLLDLYLDY