Information report for Tp57577_TGAC_v2_mRNA32821
Gene Details
|
|
Functional Annotation
- Refseq: XP_003591359.1 — transcription factor MYB108
- Swissprot: Q10MB4 — MYB2_ORYSJ; Transcription factor MYB2
- TrEMBL: A0A2K3LUS6 — A0A2K3LUS6_TRIPR; MYB-related protein P-like
- STRING: AES61610 — (Medicago truncatula)
- GO:0009414 — Biological Process — response to water deprivation
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0016036 — Biological Process — cellular response to phosphate starvation
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0005634 — Cellular Component — nucleus
- GO:0001046 — Molecular Function — core promoter sequence-specific DNA binding
- GO:0005516 — Molecular Function — calmodulin binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Actinidia chinensis: Achn228371
- Arachis hypogaea: Ahy013419
- Cajanus cajan: C.cajan_02320
- Cicer arietinum: XP_004495885.1, XP_004495882.2
- Glycine max: Glyma.02G009800.1.p, Glyma.19G218800.1.p, Glyma.10G010400.1.p, Glyma.03G221700.1.p, Glyma.10G010300.1.p
- Gossypium arboreum: Cotton_A_19829_BGI-A2_v1.0
- Malus domestica: MDP0000823458
- Medicago truncatula: Medtr1g086530.1, Medtr1g086510.1
- Pyrus bretschneideri: Pbr008630.1, Pbr001709.1
Sequences
CDS Sequence:
- >Tp57577_TGAC_v2_mRNA32821|Trifolium_pratense|MYB|Tp57577_TGAC_v2_mRNA32821
ATGGATACCAATTACAAAACCAATGTTCATGTAATGAGGAGTTTATCAGATTGTGGTTCATCAGAAGCAAATGTAAGTGAAGAAGATATTATGGTGATAAAGAAAGGTCCATGGACAGAGGATGAAGATGCTGTTCTCATGAACTATGTGGCTGTTCACGGCGAAGGTCATTGGAACTCTGTCGCTCGCTGTTCCGGACTAAAGCGAACTGGGAAAAGTTGTAGATTAAGATGGTTGAACTACTTACGTCCGAATGTTCGACGTGGAAATATCACTCTCCAAGAACAGATTTTGATTCTTGATCTCCATTCGCGTTGGGGAAATCGGTGGTCTAAAATAGCGGAACAATTGCCAGGAAGAACAGACAATGAGATAAAGAACTATTGGAGGACGAGAGTGGTAAAGCAAGCTAGACAACTCAAATGTGATGTAAACAGCAAACAGTTTAGGGACATGTTGCGTTATGAATGGATTCCACGTCTCATCGAGAGGATCCAATCTACTTGCACAACTGCAGATACTAATTCCTATAGTCAGACGCAAACCACCAATTGCAATAATACTAAAGCTCATAGTGACACTTGTGGTGCAAATACAAATCCTCTCATGTTGTCCTCTGATGTTTCATCGTACTCCTCAGAGGTCGATGTTTTAGTAGAATCAAACATATCTAATAATAATTTAATGGATAGTGCGGAATTCGGTTCCACGTGGCAGGAGTGGAATTGCTTAGACTCAAACATACAAGGATTTGAACAGAACAATGGTTTTCTTGGTGGTTCTGAATTATGGACAGATGAAAACATATGGTTCTTGCAGCAGCAACTTGCTGATGATTTATGA
Protein Sequence:
- >Tp57577_TGAC_v2_mRNA32821|Trifolium_pratense|MYB|Tp57577_TGAC_v2_mRNA32821
MDTNYKTNVHVMRSLSDCGSSEANVSEEDIMVIKKGPWTEDEDAVLMNYVAVHGEGHWNSVARCSGLKRTGKSCRLRWLNYLRPNVRRGNITLQEQILILDLHSRWGNRWSKIAEQLPGRTDNEIKNYWRTRVVKQARQLKCDVNSKQFRDMLRYEWIPRLIERIQSTCTTADTNSYSQTQTTNCNNTKAHSDTCGANTNPLMLSSDVSSYSSEVDVLVESNISNNNLMDSAEFGSTWQEWNCLDSNIQGFEQNNGFLGGSELWTDENIWFLQQQLADDL*