Information report for Tp3g05440
Gene Details
Functional Annotation
- Refseq: XP_013646372.1 — transcription factor MYB108
- Refseq: XP_020889436.1 — transcription factor MYB108
- Swissprot: Q9LDE1 — MY108_ARATH; Transcription factor MYB108
- TrEMBL: A0A1J3FMH0 — A0A1J3FMH0_NOCCA; Uncharacterized protein (Fragment)
- STRING: Cagra.9553s0006.1.p — (Capsella grandiflora)
- GO:0009620 — Biological Process — response to fungus
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Arabidopsis thaliana: AT3G06490.1, AT3G06490, AT5G49620.1
- Brassica napus: GSBRNA2T00108589001, GSBRNA2T00057532001, GSBRNA2T00120095001, GSBRNA2T00027069001
- Brassica oleracea: XP_013584371.1, XP_013584557.1, XP_013623662.1
- Brassica rapa: XP_009124852.1, XP_009147158.1, XP_009134903.1, XP_009134904.1
- Raphanus raphanistrum: RrC6693_p1
Sequences
CDS Sequence:
- >Tp3g05440|Thellungiella_parvula|MYB|Tp3g05440
ATGGATGAGAAAGGAAGAAGCTTGAAGAATAACAACATGGAAGACGAAATGGACCTGAAGAGAGGTCCATGGACCGCTGAAGAAGATTTTAAGCTCATGAATTACATTGCTACTCATGGAGAAGGTCGATGGAACTCTCTTTCTCGTTGCGCTGGACTCCAACGCACCGGTAAAAGCTGTAGGCTACGGTGGTTAAACTATCTCCGCCCTGACGTCCGCCGTGGAAACATTACCCTCGAAGAACAACTCTTGATCCTCGAACTTCATTCCCGTTGGGGCAATCGATGGTCAAAAATCGCACAGTATCTACCGGGAAGAACAGACAATGAGATCAAAAACTACTGGAGAACGCGAGTGCAAAAGCATGCAAAGCAGCTTAAGTGCGATGTAAACAGTCAACAATTCAAAGACACAATGAAGTACTTGTGGATGCCTCGGCTCGTCGAGAGGATCCAATCCGCCTCGGCCTCAGCCTCAGCCTCAGCCTCAGCCGCAGCCGTAGCCACCACCACCACGACAGGATCAGCAGCCACGTCATCTTGCATTACAACCTCTAACAATCAATTCATGACGTATGATTACAACAACAATAGCATGGGACAACAGTTTGGTGTAATCAACAACAACGACTATATCACGCCGGAAAATTCCAGCGTGGCACTGTCTCCGGTGTCAGACTTGACGGAGTACTACAGCGCTCCAAACCCGAACCCGGAATACTATTCGGGTCAAGTGGGTAATAGTTATTATCCGGATCAGAATTTGGTGGGTCCACAAATGTTACCGGAGAATTATTTCGATTATTCTGGATTACTAGACGAAGATCTACCGGCTATGCAGGAGCAGAGTAACCCTAACTGGTTTGAAAATATTAATGGAGCTGTTTCGTCTTCTTCGGACAGTTTATGGAACATTGGAGAAAGTGATGAAGACTTCTGGTTTTTACAGCAGCAACAAGAGTTCAACAATAATGGCAACTTCTGA
Protein Sequence:
- >Tp3g05440|Thellungiella_parvula|MYB|Tp3g05440
MDEKGRSLKNNNMEDEMDLKRGPWTAEEDFKLMNYIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYLRPDVRRGNITLEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDTMKYLWMPRLVERIQSASASASASASAAAVATTTTTGSAATSSCITTSNNQFMTYDYNNNSMGQQFGVINNNDYITPENSSVALSPVSDLTEYYSAPNPNPEYYSGQVGNSYYPDQNLVGPQMLPENYFDYSGLLDEDLPAMQEQSNPNWFENINGAVSSSSDSLWNIGESDEDFWFLQQQQEFNNNGNF