Information report for Tp2g24620
Gene Details
Functional Annotation
- Refseq: NP_200950.1 — myb domain protein 28
- Swissprot: Q9SPG2 — MYB28_ARATH; Transcription factor MYB28
- TrEMBL: A0A178UN88 — A0A178UN88_ARATH; PMG1
- STRING: AT5G61420.2 — (Arabidopsis thaliana)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009625 — Biological Process — response to insect
- GO:0009682 — Biological Process — induced systemic resistance
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0010439 — Biological Process — regulation of glucosinolate biosynthetic process
- GO:0050832 — Biological Process — defense response to fungus
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Arabidopsis thaliana: AT5G61420.2, AT5G61420.1
- Brassica napus: GSBRNA2T00040913001, GSBRNA2T00113547001, BnaA3.MYB28
- Brassica oleracea: XP_013593533.1, XP_013593532.1, XP_013621594.1, XP_013606292.1
- Brassica rapa: XP_009111992.1, XP_009136470.1, XP_009130172.1
- Raphanus raphanistrum: RrC1007_p5, RrC21134_p1
Sequences
CDS Sequence:
- >Tp2g24620|Thellungiella_parvula|MYB|Tp2g24620
ATGTCAAGAAAGCCATGTTGTGTCGGAGAAGGGCTGAAGAAAGGGGCATGGACCACCGAGGAAGACAAGAAACTCATCTCTTACATCCACGAATACGGAGAAGGAGGGTGGCGCGACATTCCCCAAAAGGCTGGGTTGAAAAGGTGTGGAAAGAGTTGTAGACTGCGATGGACTAATTACCTAAAACCTGAAATCAAAAGAGGCGAGTTCAGTTCAGAGGAGGAACAGATTATCATCATGCTTCATGCTTCTCGTGGCAACAAGTGGTCGGTCATAGCGAGACATTTACCTAGACGAACAGACAACGAGATCAAGAATTACTGGAACACGCATCTCAAAAAACGTCTGATGGAACAGGGTATTGACCCCGTGACGCACAAGCCACTAGCTTCTGATACTAGCCCTACTGTCACCACGCCGCCTGAAAATTTGCATTCCCTAGATGCATCTAGTTCCGACAAGCAATACTCCCGCTCGAGCTCAATGCCTTCCCTGTCTCTTCCTCCCTCCTCCGGTTTCAACACGGTTTCCGAGATTACCAGCAATGATGGGACACCAGTTCAGGAGGGTTCCTTGAGTTGCAAGAAAATTTATAAGAAATCGAGTTCTACATCAAGGCTTTTAAACAAAGTTGCGGCTAAGGCCACTACCATCAAAGAAATTTTGTCGGCTTCCATGGAAGGTAGCTTGAGTTCTACTTCAGTATCATATTCAAGCTTCTCCAGTGGCTTCTCTGAGCAGATTCCCAATGAAGAGGATAGTTCCACTGCATCCCTGACAAATACTCGTACTGAATTCGATCCCTTTTCCCACTCATCGTTGTACCCCCAGCACGAGATCAATGCTACTACTGATCTCGATATGGATCAGGGTTACGATTTCTCACATTTTCTCGAACAAATCGGGAGAGATGACCAAGACGAGGAGAACAATATGAACGTCGAGTATGGTCATGATATTCTAATGTCCGATGTGTCCCAAGAAGTCTTATCAACTAGCGTTGATGATCAAGACAATATGATTGGAAGCTTCGAAGGTTGGTCAGATTATCTTCTTGATCATGCTGGTTATATATATGACAGGGACTCTGATTCCCTTGAACAGCATTACATATGA
Protein Sequence:
- >Tp2g24620|Thellungiella_parvula|MYB|Tp2g24620
MSRKPCCVGEGLKKGAWTTEEDKKLISYIHEYGEGGWRDIPQKAGLKRCGKSCRLRWTNYLKPEIKRGEFSSEEEQIIIMLHASRGNKWSVIARHLPRRTDNEIKNYWNTHLKKRLMEQGIDPVTHKPLASDTSPTVTTPPENLHSLDASSSDKQYSRSSSMPSLSLPPSSGFNTVSEITSNDGTPVQEGSLSCKKIYKKSSSTSRLLNKVAAKATTIKEILSASMEGSLSSTSVSYSSFSSGFSEQIPNEEDSSTASLTNTRTEFDPFSHSSLYPQHEINATTDLDMDQGYDFSHFLEQIGRDDQDEENNMNVEYGHDILMSDVSQEVLSTSVDDQDNMIGSFEGWSDYLLDHAGYIYDRDSDSLEQHYI