Information report for Tp2g24200
Gene Details
Functional Annotation
- Refseq: XP_009136410.1 — PREDICTED: transcription factor MYB34
- Refseq: XP_013670352.1 — transcription factor MYB34
- Swissprot: O64399 — MYB34_ARATH; Transcription factor MYB34
- TrEMBL: A0A286QYA9 — A0A286QYA9_ISATI; MYB transcription factor 34
- STRING: Bra013000.1-P — (Brassica rapa)
- GO:0000162 — Biological Process — tryptophan biosynthetic process
- GO:0002213 — Biological Process — defense response to insect
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0009759 — Biological Process — indole glucosinolate biosynthetic process
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Arabidopsis thaliana: AT5G60890.1
- Brassica napus: GSBRNA2T00113599001, GSBRNA2T00003879001, GSBRNA2T00094719001, GSBRNA2T00146117001, GSBRNA2T00075529001, GSBRNA2T00071741001
- Brassica oleracea: XP_013595580.1, XP_013595579.1, XP_013616108.1, XP_013616107.1, XP_013616105.1, XP_013616104.1, XP_013616103.1, XP_013616102.1, XP_013610140.1, XP_013610139.1, XP_013618713.1
- Brassica rapa: XP_009136410.1, XP_009111962.1
- Raphanus raphanistrum: RrC1783_p1, RrC21907_p1
Sequences
CDS Sequence:
- >Tp2g24200|Thellungiella_parvula|MYB|Tp2g24200
ATGGTGAGAACACCATGTTGCAAAGAAGAAGGAATAAAGAAAGGAGCTTGGACTCCTGAAGAAGATCAAAAGCTTATTGCTTATGTTCAACTACATGGTGAAGGAGGATGGCGTACTCTCCCGGAAAAAGCTGGATTGAAAAGATGTGGGAAAAGTTGTAGACTGAGATGGGCTAATTACTTAAGACCCGACATTAAGAGAGGAGAGTTTACTCCTGAAGAAGACGACACTATTATCAAGCTTCATGCTCTCAAGGGTAACAAGTGGGCCGCAATAGCAACTAGTTTGGCGGGACGAACAGACAACGAGATAAAAAATTATTGGAACACAAATCTCAAGAAGCGTTTGAAACAGAAAGGTCTCGATCCAATCACCCACAAAAAACCGATCGATTCAACCGATCAAACCGATTTCAAACCGAAAAACCGTAAATTCGGTTCATCCGGTTCCGCAAAGCTTCTTAACCGCGTCGCAAGCAAATATGCGGTCGATTTAAACCGGGATCTACTAACCGGAATCATCATCGGAAACTCTACGATCACCGTCGATGACTCACAAAACTCCAGCGAGATGGATTCACCGACCAAAAATTCGACCTCAACAGTGCTCAACAAAACGGCGGCAAATTCAAGCGCTCTCACATCGATTCTGATCAACAATGCATCGACATCTTCCGGTTTATCCGACAACTGTTCTTTCTCCGATGATTTCAACGAATTCTTTAGCAACGAAGAGATCTCCAATATGTATACAAATGTCGATAATATTGGCCTCATGGAAGAGTTACAGGGTATTTTAGGCTACGGTGGTGCCGATATCGGAGATATTAAGGATTCGCCGGTGGTTAACGTAACTGATGAAATGGAGTTTCTTGATTCTTGGAACGAAGAAGATGATATGGATTTGGAAAAGTTTGTGAGTTCGTTAGATTCCAAGATTGGTGTCTTTGTCTGA
Protein Sequence:
- >Tp2g24200|Thellungiella_parvula|MYB|Tp2g24200
MVRTPCCKEEGIKKGAWTPEEDQKLIAYVQLHGEGGWRTLPEKAGLKRCGKSCRLRWANYLRPDIKRGEFTPEEDDTIIKLHALKGNKWAAIATSLAGRTDNEIKNYWNTNLKKRLKQKGLDPITHKKPIDSTDQTDFKPKNRKFGSSGSAKLLNRVASKYAVDLNRDLLTGIIIGNSTITVDDSQNSSEMDSPTKNSTSTVLNKTAANSSALTSILINNASTSSGLSDNCSFSDDFNEFFSNEEISNMYTNVDNIGLMEELQGILGYGGADIGDIKDSPVVNVTDEMEFLDSWNEEDDMDLEKFVSSLDSKIGVFV