Information report for Spipo0G0131000
Gene Details
|
|
Functional Annotation
- Refseq: XP_010256736.1 — PREDICTED: uncharacterized protein LOC104597048 isoform X1
- Refseq: XP_014515157.1 — transcription factor MYB1
- Refseq: XP_017442242.1 — PREDICTED: transcriptional activator Myb isoform X1
- Swissprot: Q42575 — MYB1_ARATH; Transcription factor MYB1
- TrEMBL: A0A1D1XU25 — A0A1D1XU25_9ARAE; Transcription factor MYB44 (Fragment)
- TrEMBL: A0A200R4S3 — A0A200R4S3_9MAGN; SANT/Myb domain
- STRING: XP_010256736.1 — (Nelumbo nucifera)
- GO:0009651 — Biological Process — response to salt stress
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0005634 — Cellular Component — nucleus
- GO:0005737 — Cellular Component — cytoplasm
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_34992, C.cajan_27944
- Cicer arietinum: XP_012567497.1
- Citrullus lanatus: Cla018139
- Cucumis melo: MELO3C003212P1
- Cucumis sativus: Cucsa.066910.2, Cucsa.066910.1
- Lactuca sativa: Lsa013029
- Musa acuminata: GSMUA_Achr9P03720_001, GSMUA_Achr6P33470_001
- Nicotiana benthamiana: Niben101Scf01406g03020.1
- Nicotiana tabacum: XP_016483070.1, XP_016450102.1
- Prunus mume: XP_008239931.1
- Sesamum indicum: XP_011094946.1
- Solanum lycopersicum: Solyc09g011780.2.1
- Vitis vinifera: GSVIVT01034041001
Sequences
CDS Sequence:
- >Spipo0G0131000|Spirodela_polyrhiza|MYB|Spipo0G0131000
ATGGTCTCCGTTACATCACGCTATGGGCCTCTTGGAAAATCCCACACCGAGAAAGGGAAAATGTGGTCCAATGGGCTGGAGGAAATTGGAAGGCGGGCTCATAATGGGCCGATACACGACGGTTTTTGGGCCAACTTTTCCGGAGAGGACGGAGAAACCCTGGTAAGCTGCTGGGGATTGGGGGAGGACAGGGTGAAGGGGCCGTGGTCGCCGGAGGAGGATGTCATCCTGAGCCGTCTCGTGAGCAAGTTTGGCGCCAGGAATTGGAGCCTCATAGCCAGGGGCATCCCTGGGCGCACCGGGAAATCGTGTCGGCTGCGGTGGTGCAACCAGCTCGACCCCACTGTCAAGCGCCAGCCATTCACTGAGGAAGAGGACCGGATCATCGTGGCCGCCCACGCCGTCCATGGGAACAAATGGGCCTCCATAGCGAGGCTGCTGGAAGGGAGAACGGACAACGCAATCAAGAACCACTGGAACTCCACCCTGAAGCGGCGGTGTGTGGAGGCCGGCAAGCCCAGGAATGCAGCCCTGGAGGAGGTGAGGGTCTCATCGGAGGATGGGTTATCGTTTGGTGAGGCGAGCTCTTTCAGCCCCAGCCAGGAGGTTGCCTCTGGGAGCTCCTTGCTGGGACCGGAGTTTGTTGAATATGCCGAGGAAACTGCAGTGCCCGGCCTGGAAGTGGCGTCCATAGCTAGAGATTTGAGCAGTGCCGCATGGATGAGGAGCAGCTTCACCGCCGAGGTGATGCCCAGGCTCTGGAATCACAGCCCGAGATGA
Protein Sequence:
- >Spipo0G0131000|Spirodela_polyrhiza|MYB|Spipo0G0131000
MVSVTSRYGPLGKSHTEKGKMWSNGLEEIGRRAHNGPIHDGFWANFSGEDGETLVSCWGLGEDRVKGPWSPEEDVILSRLVSKFGARNWSLIARGIPGRTGKSCRLRWCNQLDPTVKRQPFTEEEDRIIVAAHAVHGNKWASIARLLEGRTDNAIKNHWNSTLKRRCVEAGKPRNAALEEVRVSSEDGLSFGEASSFSPSQEVASGSSLLGPEFVEYAEETAVPGLEVASIARDLSSAAWMRSSFTAEVMPRLWNHSPR*