Information report for RrC1436_p1
Gene Details
|
|
Functional Annotation
- Refseq: XP_018449721.1 — PREDICTED: transcription repressor MYB6
- Swissprot: Q8VZQ2 — MYB61_ARATH; Transcription factor MYB61
- TrEMBL: A0A3P6BPI4 — A0A3P6BPI4_BRACM; Uncharacterized protein
- STRING: Bra030783.1-P — (Brassica rapa)
- GO:0001944 — Biological Process — vasculature development
- GO:0009733 — Biological Process — response to auxin
- GO:0010089 — Biological Process — xylem development
- GO:0010119 — Biological Process — regulation of stomatal movement
- GO:0010214 — Biological Process — seed coat development
- GO:0048364 — Biological Process — root development
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Arabidopsis thaliana: AT1G09540.1
- Brassica napus: GSBRNA2T00047158001, GSBRNA2T00051582001, GSBRNA2T00122295001, GSBRNA2T00019304001, GSBRNA2T00097742001, GSBRNA2T00156174001
- Brassica oleracea: XP_013603204.1, XP_013584656.1, XP_013603380.1
- Brassica rapa: XP_009110822.1, XP_009148252.1, XP_009118313.1
Sequences
CDS Sequence:
- >RrC1436_p1|Raphanus_raphanistrum|MYB|RrC1436_p1
ATGGGGAGACATTCTTGCTGTTACAAACAAAAGCTGAGAAAAGGGCTTTGGTCTCCTGATGAAGACGAGAAGCTTCTCAACCACATTACCAATCATGGTCATGGCTGCTGGAGCTCTGTTCCTAAACTTGCCGGTTTGCAGAGATGTGGTAAAAGTTGTAGACTGAGATGGATCAATTACTTGAGACCTGATTTAAAGAGAGGAGCTTTCTCTCCAGAAGAAGAGAATCTCATCGTCGAGCTTCATGCAGTCCTTGGAAACAGATGGTCACAGATTGCAGCTAAACTTCCGGGAAGAACCGACAACGAGATCAAGAATCTATGGAACTCGAGTATAAAAAAGAAACTGAGGCAAAGAGGCATTGACCCAAACACACACAAACCTATCCCCGAAGTTGACAAAGACAAACCAACAAGAAGCAGCAACAACGACCACAAGTCTCCTAGTTCATCCGCTGCAACTAACCAAGACTTCTTCCTCGAAAGGCCATCTGATTTCTCAGACTACTTCGGTCTTCAGAAGCTTAACTTCAACTCCAACCTCGGACTCTCTGCTACACCCGAGTCTTCTCTCTGTACCATGGGAAACATGGTTGGTTCTGTCTTTCAGACTCAGGTTTGCGTGAAGCCTTCAATTAGTCTCCCTCCGGACAGCAGTTCGAGTACGGTCTCCAGAGGAGATCATGCAGCATCTAGCTGGGAGTTTCAGACAAACAACACCTCGAACTTCTTTGATAACGGTGGATTCTCATGGCCAATCACAAACCCTTCTTCTTCGGTAGCTAAACCTAATCATAACTTTGAAGAAGTGAAATGGTCAGAGTATTTGAACACACCGTTCTTCAATGGAAGCACCGTACAGAGCCAAAACTCTCAACAGATCTGCATCAAATCAGAGGCAGAGTACTTAGCCAAAGTTTCGAACATGTCAGATCCTTGGAGCCAAAGCCAGAACGAGAATCTAGGCACACCTGAAGCTAGTGACGTGTTCTCCAAGGATCTTCAGAGAATGGCCGTCTCTTTTGGTCAGTCCCTTTAG
Protein Sequence:
- >RrC1436_p1|Raphanus_raphanistrum|MYB|RrC1436_p1
MGRHSCCYKQKLRKGLWSPDEDEKLLNHITNHGHGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLKRGAFSPEEENLIVELHAVLGNRWSQIAAKLPGRTDNEIKNLWNSSIKKKLRQRGIDPNTHKPIPEVDKDKPTRSSNNDHKSPSSSAATNQDFFLERPSDFSDYFGLQKLNFNSNLGLSATPESSLCTMGNMVGSVFQTQVCVKPSISLPPDSSSSTVSRGDHAASSWEFQTNNTSNFFDNGGFSWPITNPSSSVAKPNHNFEEVKWSEYLNTPFFNGSTVQSQNSQQICIKSEAEYLAKVSNMSDPWSQSQNENLGTPEASDVFSKDLQRMAVSFGQSL