Gene Details:

  • Gene ID: PH01002122G0230
  • Gene Family: MYB Family
  • Description: MYB Family protein
  • Species: Phyllostachys heterocycla
  • Source: MYB family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006664658.1  — PREDICTED: protein rough sheath 2 homolog
  • Swissprot:  Q9S7B2  — RS2_MAIZE; Protein rough sheath 2
  • TrEMBL:  A0A3B6KEE6  — A0A3B6KEE6_WHEAT; Uncharacterized protein
  • TrEMBL:  A0A453JX53  — A0A453JX53_AEGTS; Uncharacterized protein
  • STRING:  OB12G23330.1  — (Oryza brachyantha)
  • STRING:  Traes_5BS_E635B0A281.2  — (Triticum aestivum)

Gene Ontology:

  • GO:0008356  — Biological Process — asymmetric cell division
  • GO:0009615  — Biological Process — response to virus
  • GO:0009651  — Biological Process — response to salt stress
  • GO:0009733  — Biological Process — response to auxin
  • GO:0009739  — Biological Process — response to gibberellin
  • GO:0009751  — Biological Process — response to salicylic acid
  • GO:0009753  — Biological Process — response to jasmonic acid
  • GO:0009944  — Biological Process — polarity specification of adaxial/abaxial axis
  • GO:0010338  — Biological Process — leaf formation
  • GO:0042742  — Biological Process — defense response to bacterium
  • GO:0045088  — Biological Process — regulation of innate immune response
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0046686  — Biological Process — response to cadmium ion
  • GO:0050832  — Biological Process — defense response to fungus
  • GO:0000793  — Cellular Component — condensed chromosome
  • GO:0005730  — Cellular Component — nucleolus
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0042803  — Molecular Function — protein homodimerization activity

Family Introduction:

  • MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
  • In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.

Literature:

Sequences:

CDS Sequence:
  • >PH01002122G0230|Phyllostachys_heterocycla|MYB|PH01002122G0230
    ATGAAGGAACGACAGCGGTGGCGGCCTGAGGAAGACGCCATCCTGCGCTCGTACGTCCGGCAGTATGGTCCGCGGGAGTGGAACCTGGTGGCGCAGCGGATGAACGTCGCTCTCGACCGCGACGCCAAGTCGTGCCTTGAGCGGTGGAAGAACTACCTCCGGCCGGGGATCAAGAAGGGCTCGCTCAGCGAGGAGGAGCAGCGGCTGGCCAAGCACGGCAACAAGTGGAAGAAGATCGCCGCCGAGGTGCCGGGGCGCACGGCGAAGCGGCTCGGCAAGTGGTGGGAGGTGTTCAAGGAGAAGCAGCAGCGGGAGCTCAGGGATAGCCGGAGGCCGCCGCCGGAGCCCAGCCCCGACGAGAGGGGCAGGTACGAGTGGCTGCTCGAGAACTTCGCGGAGAAGCTCGTCAAGGAGCGGCAGGTCGCGCCGCTGCTCATGGCCGCGCCCATGCTCCCGCCCTGGATGTCGTCCACGCCTTTGATCGTGCCAAGTTTCGTTTCTTAG
Protein Sequence:
  • >PH01002122G0230|Phyllostachys_heterocycla|MYB|PH01002122G0230
    MKERQRWRPEEDAILRSYVRQYGPREWNLVAQRMNVALDRDAKSCLERWKNYLRPGIKKGSLSEEEQRLAKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQRELRDSRRPPPEPSPDERGRYEWLLENFAEKLVKERQVAPLLMAAPMLPPWMSSTPLIVPSFVS*