Information report for PEQU_23598
Gene Details
|
|
Functional Annotation
- Refseq: XP_020592623.1 — transcription factor MYB48-like
- TrEMBL: A0A2I0VSY0 — A0A2I0VSY0_9ASPA; Transcription factor GAMYB
- STRING: GSMUA_Achr1P17150_001 — (Musa acuminata)
- GO:0009555 — Biological Process — pollen development
- GO:0009789 — Biological Process — positive regulation of abscisic acid-activated signaling pathway
- GO:0043068 — Biological Process — positive regulation of programmed cell death
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0090406 — Cellular Component — pollen tube
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Brachypodium distachyon: Bradi2g53010.1.p
- Citrus sinensis: orange1.1g039708m
- Manihot esculenta: Manes.04G153700.3.p, Manes.04G153700.2.p, Manes.04G153700.1.p
- Musa acuminata: GSMUA_Achr1P17150_001
- Populus trichocarpa: Potri.003G189700.4
- Sesamum indicum: XP_011080499.1, XP_011080498.1, XP_011080497.1
- Vitis vinifera: GSVIVT01030434001
- Ziziphus jujuba: XP_015881129.1
Sequences
CDS Sequence:
- >PEQU_23598|Phalaenopsis_equestris|MYB|PEQU_23598
ATGACAAACTTAGATAGTTTTAATTGTACATACGATAAGAAGACAGCAGTAGACATAAAAGAAGAGCCCGGAGTCGTCCCTCCGGCTAAATCTTCTGCCAATGCCGGGCCACCAGAGGCTTCACCATTGAAGAAGGGACCCTGGACTGCAGCAGAAGATGCAATTTTGATAGAGTATGTAAAGACGCATGGGGAAGGTAATTGGAATGCCGTTCAAAAGAACATCGGGCTGCAACGTTGTGGCAAGAGTTGCCGTCTTCGATGGGCTAATCATCTTCGTCCCAATTTAAAAAAAGGATCTTTTTCTCCAGAAGAAGAAGCTCTTATACTTTATCTTCATTCTCAGCTTGGCAACAAATGGGCTCGAATGGCTGCGCATTTGCCAGGCAGAACAGACAATGAGATAAAGAATTATTGGAACACGAGAATCAAAAGACGGCAAAGAGCGGGGCTTCCGCTTTATCCACCCAACATTCAGCAGAAAGTTGATGGTCAGAACCAAAGACAGGAGACGTTCACCAACATCCAAAAGCATTGTTTGGCAAAAAATTATAATCCTCATATTTCTCCAACTATGACCACTGGATATGATAATATTGACACTGTTAATGGCAACACGAATTACATCGGAAACTTCAATGATAACGAATCACCTCAACAACTTCAATCATTTTATTGTCCTGTCAAGATGGAGCACAGTCCAACAGCATTATTACCTCCCTATATTGAGAATCAAAATTGGCTTGTGCCACCGCCAACAACAACGCTTGTGGACTACAACAATATATATCATCATAATCAATTTAAAGGTTCACAATTTCCTGAGAAACTATACAATCAAGATGTTTTGCTTGAGAACATGCCACTCAGCAGTGTTGCTGCAATGGAGCCTCCATCTCCACGGCTGCCATCAACTCCGAACTGTAACGAATCAATCATGAATTGCTTCTATCATATGGATAACTCGAATAACTCATATAACACTTCAGGTGAACTCTTTTAA
Protein Sequence:
- >PEQU_23598|Phalaenopsis_equestris|MYB|PEQU_23598
MTNLDSFNCTYDKKTAVDIKEEPGVVPPAKSSANAGPPEASPLKKGPWTAAEDAILIEYVKTHGEGNWNAVQKNIGLQRCGKSCRLRWANHLRPNLKKGSFSPEEEALILYLHSQLGNKWARMAAHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPNIQQKVDGQNQRQETFTNIQKHCLAKNYNPHISPTMTTGYDNIDTVNGNTNYIGNFNDNESPQQLQSFYCPVKMEHSPTALLPPYIENQNWLVPPPTTTLVDYNNIYHHNQFKGSQFPEKLYNQDVLLENMPLSSVAAMEPPSPRLPSTPNCNESIMNCFYHMDNSNNSYNTSGELF