Information report for ORUFI04G25410.1
Gene Details
|
|
Functional Annotation
- Refseq: XP_015635813.1 — myb-related protein Zm1
- Swissprot: P20024 — MYB1_MAIZE; Myb-related protein Zm1
- TrEMBL: A0A0E0PDG2 — A0A0E0PDG2_ORYRU; Uncharacterized protein
- TrEMBL: Q0JAJ7 — Q0JAJ7_ORYSJ; OSJNBa0009P12.32 protein
- TrEMBL: Q7X793 — Q7X793_ORYSA; OSIGBa0142I02-OSIGBa0101B20.27 protein
- STRING: ORUFI04G25410.1 — (Oryza rufipogon)
- STRING: OS04T0594100-01 — (Oryza sativa)
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:2000652 — Biological Process — regulation of secondary cell wall biogenesis
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Brachypodium distachyon: Bradi5g20130.1.p
- Oryza sativa: OsMYB58;OsMYB63
- Panicum virgatum: Pavir.7NG289500.1.p, Pavir.7KG317800.1.p
- Setaria italica: Seita.7G220500.1.p
- Setaria viridis: Sevir.7G232200.1.p
- Triticum aestivum: Traes_2BL_FD8C2F815.1, Traes_2AL_CC403D182.1, Traes_2DL_D39684C41.1, Traes_2BL_34A0848F2.1
- Zea mays: GRMZM2G038722_P01
Sequences
CDS Sequence:
- >ORUFI04G25410.1|Oryza_rufipogon|MYB|ORUFI04G25410.1
ATGGGGAAGGGCCGGGCACCGTGCTGCGCCAAGGTGGGGCTGAACAAGGGGTCGTGGACGCCGGAGGAGGACATGAGGCTCGTCGCCTACATTCAGAAGTACGGCCACGCCAACTGGCGCGCCCTGCCCAAGCAAGCAGGTTTGCTCCGGTGCGGGAAGAGCTGCCGACTCCGGTGGATCAACTACCTCCGGCCGGACCTCAAGCGCGGCAACTTCACCGCCGAGGAGGAGGAGACCATCATCAAGCTTCACGGCCTTCTCGGCAACAAGTGGTCGAAGATCGCGTCGTGCCTGCCGGGGAGGACGGACAACGAGATCAAGAACGTCTGGAACACGCACCTCAAGAAGCGGGTGTCGCCGGAGCAGAAGAAGGGTGGGGGCAAGAGCAAGAAGAAGACGACCTGCACCGACGTGCTCGTCCCGTCCCCATCGCCGTCGTCGTCCACCACCACCACGACCAACTGCTCCAGCGGCGACTCAGCCGGCGAGCAGAGCAACACGAGCAAGGAGGAGGAGGAGGAGACGGACAAGATCGAGATCCCCATGCTCGAGCTCGACCCCTGCTGCTTCGACTTCGACATGCTGGTTGACCCCGTTGTCCCGGACACGTACTGCCCCGCGGTGTCGGCGTCGGCGTCGGCGTCGGCGCCGACGTCGCCGTGCTCGTCCACGTCCCCGTCGTGCGCCCGTGCAGGCGTGGACCCGCTGCTCGACCTGCCCGAAATCGTGGACCTCGGGCCGGAGCTATGGAGCATCATGGACGGCGGCGCCGGCGACGGGTGCACCGAAGCGCCGCCGCCGGCGTGGAGCAATGCGGCGGCGGCGGCGGCGGCCAATGCAACAGTGGCCACCACGACCAGCCTGGAGGAGGAGGAGGGGAAGGAGTGGTGGTTGGAGGACTTGGAGAAGGAGCTCGGGCTGTGGGGGCCCACGGACGACTACCACTGCCACCCGGGCCCACAAGGTCAGCCCGGTCGCGCGGGCCCACCACCCTCCGCCGTTGTGGAGGACCCAGTGTCGTGCTACTTCCAAGCGGGCCCCACGGCAGCCGCCACGTGGCAGGGACACGAGCCCTCGGCTGTCATCACGAGTAACCCCATGGATTACTACGTGTAA
Protein Sequence:
- >ORUFI04G25410.1|Oryza_rufipogon|MYB|ORUFI04G25410.1
MGKGRAPCCAKVGLNKGSWTPEEDMRLVAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTAEEEETIIKLHGLLGNKWSKIASCLPGRTDNEIKNVWNTHLKKRVSPEQKKGGGKSKKKTTCTDVLVPSPSPSSSTTTTTNCSSGDSAGEQSNTSKEEEEETDKIEIPMLELDPCCFDFDMLVDPVVPDTYCPAVSASASASAPTSPCSSTSPSCARAGVDPLLDLPEIVDLGPELWSIMDGGAGDGCTEAPPPAWSNAAAAAAANATVATTTSLEEEEGKEWWLEDLEKELGLWGPTDDYHCHPGPQGQPGRAGPPPSAVVEDPVSCYFQAGPTAAATWQGHEPSAVITSNPMDYYV