Information report for orange1.1g044977m
Gene Details
|
|
Functional Annotation
- Refseq: XP_024041077.1 — transcription factor MYB124
- Swissprot: Q94FL6 — MY124_ARATH; Transcription factor MYB124
- TrEMBL: A0A067GT21 — A0A067GT21_CITSI; Uncharacterized protein
- STRING: XP_006483204.1 — (Citrus sinensis)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009553 — Biological Process — embryo sac development
- GO:0010052 — Biological Process — guard cell differentiation
- GO:0005634 — Cellular Component — nucleus
- GO:0016021 — Cellular Component — integral component of membrane
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Gossypium arboreum: Cotton_A_38326_BGI-A2_v1.0, Cotton_A_27954_BGI-A2_v1.0
- Gossypium hirsutum: Gh_D13G0754, Gh_A13G0637, Gh_A03G0859, Gh_D02G1139
- Juglans regia: WALNUT_00013395-RA
- Manihot esculenta: Manes.05G098700.1.p
- Ricinus communis: 29736.m002013
- Vitis vinifera: GSVIVT01020038001
- Ziziphus jujuba: XP_015894913.1, XP_015901913.1, XP_015894912.1, XP_015901912.1, XP_015901911.1, XP_015901910.1, XP_015901909.1
Sequences
CDS Sequence:
- >orange1.1g044977m|Citrus_sinensis|MYB|orange1.1g044977m
ATGCAAGTACCCAAGAAGAAGATTGGCTCCAATGAAGAATCCAAGAAGAAAGAAAGACATATTGTCACTTGGACTCAGCAGGAAGATGATATATTGCGTGAACAAATCAGTATACATGGAACTGAGAATTGGTCAATTATTGCGTCGAAATTCAAGGATAAAACAACCAGACAGTGCAGAAGAAGATGGTACACATACTTGAATTCAGATTTCAAGAAAGGGGGATGGTCGCCGGAGGAAGATATGCTATTATGTGAGGCTCAGAAGATATTTGGTAATAGATGGACAGAAATAGCTAAGGTGGTTTCAGGCAGAACGGATAATGCTGTCAAGAACAGATTCTCCACGTTGTGCAAGAAGAGAGCAAAATATGAAGCCTTAGCAAAAGAGAATAACAATGCATATATAAACCCAAACAACAAGAGAATTTTATTCCAAAATGGGTTCGGTACAGATGGGACTCCAGAAAATGCAGCACCTGTTAAGAAAGTGAGGAGGGCACACATCCCTGATCTCACAGAAAATTGCAACTTTGAGAACAGATCACATAGGCAATCTGGAACAGCTGCAAATCAGCATCTAAGATCTCCTTTTACTGTGTTGCCTCAGAACTTCCCCAGCATCACCCATTTGCCTGCCAAGTATCATGATGCTAAGGAGGTCTCAAATGATGGTGAGCCCCTGTTGCAAGGTTTCTGGAACTCTCAGAACAATAAAACTCAAGGAACATTTCTTAAGAAGGATGATCCAAAGATAACTGCTTTGATACAACAAGCAGAACTTCTCAGCTCACTTGCGCAGAAAGTTAATACAGAGAGCACAGAACAGAGTTTGGAAAATGCTTGGAAGGTTCTCCAAGATTTCCTGAACCGAAGCAAAGAAAATGATATTCTACGATGCAAAATCTCTGATATTGATTTGCAATTGGAAGATTTTAAAGATTTGATAGAGGACTTGAGGAGTAGCAATGATGAAAGTAGATCATCTTGGAGGCATCCTGATCTGTTTGAGGACTCTCCAGCTAGTTCTGAATATAGTACTGGATCAACTCTGATCCCTCGTCCAGCTGGTGATACAACAGATCAAATTGATGCTGAGTTAAGTGCATTGCATCAGGCTATTGGGACAGAATTACAATCAATTGATATTGCTAAGCAACATTGCTTAGTGGAACAGGATAAAGGGAGTGCAGACTCAAAGCAAGGGTTATTTACTTCTGGTGGTGAGGACACGAACAATGATGGAGCTGCCTCCACCTCATCAAGTACAGAGTTTAGTTCCCCACTCCACGTTACCCCGCTGTTCAGATCCTTAGCAGCAGGAATCCCCAGCCCAAAATTTTCAGAAAGTCGAGTTGTAGTGGTGAAAGCTGTGACAACGGTGGTGGTGACGGTTACGACTCTATCCCTGCTATTTATCAATCGATTCATAGGACTCTAG
Protein Sequence:
- >orange1.1g044977m|Citrus_sinensis|MYB|orange1.1g044977m
MQVPKKKIGSNEESKKKERHIVTWTQQEDDILREQISIHGTENWSIIASKFKDKTTRQCRRRWYTYLNSDFKKGGWSPEEDMLLCEAQKIFGNRWTEIAKVVSGRTDNAVKNRFSTLCKKRAKYEALAKENNNAYINPNNKRILFQNGFGTDGTPENAAPVKKVRRAHIPDLTENCNFENRSHRQSGTAANQHLRSPFTVLPQNFPSITHLPAKYHDAKEVSNDGEPLLQGFWNSQNNKTQGTFLKKDDPKITALIQQAELLSSLAQKVNTESTEQSLENAWKVLQDFLNRSKENDILRCKISDIDLQLEDFKDLIEDLRSSNDESRSSWRHPDLFEDSPASSEYSTGSTLIPRPAGDTTDQIDAELSALHQAIGTELQSIDIAKQHCLVEQDKGSADSKQGLFTSGGEDTNNDGAASTSSSTEFSSPLHVTPLFRSLAAGIPSPKFSESRVVVVKAVTTVVVTVTTLSLLFINRFIGL*